|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1031 |
Name | CDKN2C |
Synonym | INK4C|p18|p18-INK4C;cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4);CDKN2C;cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) |
Definition | CDK6 inhibitor p18|cyclin-dependent inhibitor|cyclin-dependent kinase 4 inhibitor C|cyclin-dependent kinase 6 inhibitor p18|p18-INK6 |
Position | 1p32 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 10 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | P18 is a tumor suppressor gene involved in human medullary thyroid carcinoma and pheochromocytoma. |
reviewed | These findings uncover a feedback regulatory circuit in the astrocytic lineage and demonstrate tumor suppressor role for p18(INK4C) in human glioblastoma wherein it functions cooperatively with other INK4 family. |
reviewed | Mutational analysis of p27 (CDKN1B) and p18 (CDKN2C) in sporadic pancreatic endocrine tumors argues against tumor-suppressor function. |
potential | "p18INK4c may function as a tumor suppressor in Hodgkin lymphoma, and inactivation may contribute to cell cycle deregulation and defective terminal differentiation of the Reed-Sternberg cells." |
reviewed | tumor suppressor INK4: determination of the solution structure of p18INK4C and demonstration of the functional significance of loops in p18INK4C and p16INK4A. |
reviewed | Expression of the p16INK4a tumor suppressor versus other INK4 family members during mouse development and aging. |
reviewed | Cdk4 inhibitor p18(Ink4c) is a tumor suppressor in cyclin D1-driven PNET. |
reviewed | "Studies identify p18(INK4c) as a glioblastoma multiforme tumor suppressor gene, revealing an additional mechanism leading to aberrant activation of cyclin/cdk complexes in this terrible malignancy." |
reviewed | The CDK inhibitor p18Ink4c is a tumor suppressor in medulloblastoma. |
reviewed | "Here we show that treatment of p18 null and heterozygous mice with a chemical carcinogen resulted in tumor development at an accelerated rate.Hence, p18 is a haploinsufficient tumor suppressor in mice." |
| More detail of all 10 literatures about CDKN2C | |
|
Pathways and Diseases |
|
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 1031 |
Links to all GeneRIF Items | 1031 |
Links to iHOP | 1031 |
|
Sequence Information |
|
Nucleotide Sequence |
>1031 : length: 507 atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactgctacttagaggt gctaatcccgatttgaaagaccgaactggtttcgctgtcattcatgatgcggccagagca ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccgggtggtggag ttcctggtgaagcacacggccagcaatgtggggcatcggaaccataagggggacaccgcc tgtgatttggccaggctctatgggaggaatgaggttgttagcctgatgcaggcaaacggg gctgggggagccacaaatcttcaataa |
Protein Sequence |
>1031 : length: 168 MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |