|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1032 |
Name | CDKN2D |
Synonym | INK4D|p19|p19-INK4D;cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4);CDKN2D;cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) |
Definition | CDK inhibitor p19INK4d|cell cycle inhibitor, Nur77 associating protein|cyclin-dependent kinase 4 inhibitor D|cyclin-dependent kinase 4 inhibitor D p19|inhibitor of cyclin-dependent kinase 4d |
Position | 19p13 |
Gene Type | protein-coding |
Source | Count: 1; UniProt |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about CDKN2D | |
|
Pathways and Diseases |
|
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | cell cycle: g2/m checkpoint;PID BioCarta;100159 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Disease | Brain tumor;FunDO |
Disease | Malignant glioma;FunDO |
|
External Links |
|
Links to Entrez Gene | 1032 |
Links to all GeneRIF Items | 1032 |
Links to iHOP | 1032 |
|
Sequence Information |
|
Nucleotide Sequence |
>1032 : length: 501 atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcatcccgacgccctcaaccgc ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc aacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact gctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccaggggtctc acacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctgcagggc cacatggtggccccgctgtga |
Protein Sequence |
>1032 : length: 166 MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL |