|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10481 |
Name | HOXB13 |
Synonym | PSGD;homeobox B13;HOXB13;homeobox B13 |
Definition | homeo box B13|homeobox protein Hox-B13 |
Position | 17q21.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | Epigenetic inactivation of the candidate tumor suppressor gene HOXB13 in human renal cell carcinoma. |
potential | "identifies several important tumor suppressors and transcription factors as direct DNMT3B targets in colon cancer and as potential biomarkers for this cancer. Further, methylation at an upstream CGI of HOXB13 is unique to colon cancer". |
potential | HOXB13 is downregulated by methylation and functions as a tumor suppressor in malignant melanoma. |
| More detail of all 3 literatures about HOXB13 | |
|
Pathways and Diseases |
|
Pathway | Regulation of Androgen receptor activity;PID Curated;200102 |
Disease | Melanoma;FunDO |
Disease | Female reproductive cancer;FunDO |
Disease | Breast cancer;FunDO |
Disease | Prostate cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 10481 |
Links to all GeneRIF Items | 10481 |
Links to iHOP | 10481 |
|
Sequence Information |
|
Nucleotide Sequence |
>10481 : length: 855 atggagcccggcaattatgccaccttggatggagccaaggatatcgaaggcttgctggga gcgggaggggggcggaatctggtcgcccactcccctctgaccagccacccagcggcgcct acgctgatgcctgctgtcaactatgcccccttggatctgccaggctcggcggagccgcca aagcaatgccacccatgccctggggtgccccaggggacgtccccagctcccgtgccttat ggttactttggaggcgggtactactcctgccgagtgtcccggagctcgctgaaaccctgt gcccaggcagccaccctggccgcgtaccccgcggagactcccacggccggggaagagtac cccagccgccccactgagtttgccttctatccgggatatccgggaacctaccagcctatg gccagttacctggacgtgtctgtggtgcagactctgggtgctcctggagaaccgcgacat gactccctgttgcctgtggacagttaccagtcttgggctctcgctggtggctggaacagc cagatgtgttgccagggagaacagaacccaccaggtcccttttggaaggcagcatttgca gactccagcgggcagcaccctcctgacgcctgcgcctttcgtcgcggccgcaagaaacgc attccgtacagcaaggggcagttgcgggagctggagcgggagtatgcggctaacaagttc atcaccaaggacaagaggcgcaagatctcggcagccaccagcctctcggagcgccagatt accatctggtttcagaaccgccgggtcaaagagaagaaggttctcgccaaggtgaagaac agcgctaccccttaa |
Protein Sequence |
>10481 : length: 284 MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP |