|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1052 |
Name | CEBPD |
Synonym | C/EBP-delta|CELF|CRP3|NF-IL6-beta;CCAAT/enhancer binding protein (C/EBP), delta;CEBPD;CCAAT/enhancer binding protein (C/EBP), delta |
Definition | CCAAT/enhancer-binding protein delta|c/EBP delta|nuclear factor NF-IL6-beta |
Position | 8p11.2-p11.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | C/EBPdelta is a novel tumor suppressor gene in acute myeloid leukemia that is silenced by promoter methylation. |
| More detail of all 1 literatures about CEBPD | |
|
Pathways and Diseases |
|
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Disease | Leukemia;FunDO |
Disease | Breast cancer;FunDO |
Disease | Prostate cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 1052 |
Links to all GeneRIF Items | 1052 |
Links to iHOP | 1052 |
|
Sequence Information |
|
Nucleotide Sequence |
>1052 : length: 810 atgagcgccgcgctcttcagcctggacggcccggcgcgcggcgcgccctggcctgcggag cctgcgcccttctacgaaccgggccgggcgggcaagccgggccgcggggccgagccaggg gccctaggcgagccaggcgccgccgcccccgccatgtacgacgacgagagcgccatcgac ttcagcgcctacatcgactccatggccgccgtgcccaccctggagctgtgccacgacgag ctcttcgccgacctcttcaacagcaatcacaaggcgggcggcgcggggcccctggagctt cttcccggcggccccgcgcgccccttgggcccgggccctgccgctccccgcctgctcaag cgcgagcccgactggggcgacggcgacgcgcccggctcgctgttgcccgcgcaggtggcc gcgtgcgcacagaccgtggtgagcttggcggccgcagggcagcccaccccgcccacgtcg ccggagccgccgcgcagcagccccaggcagacccccgcgcccggccccgcccgggagaag agcgccggcaagaggggcccggaccgcggcagccccgagtaccggcagcggcgcgagcgc aacaacatcgccgtgcgcaagagccgcgacaaggccaagcggcgcaaccaggagatgcag cagaagttggtggagctgtcggctgagaacgagaagctgcaccagcgcgtggagcagctc acgcgggacctggccggcctccggcagttcttcaagcagctgcccagcccgcccttcctg ccggccgccgggacagcagactgccggtaa |
Protein Sequence |
>1052 : length: 269 MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL TRDLAGLRQFFKQLPSPPFLPAAGTADCR |