|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10633 |
Name | RASL10A |
Synonym | RRP22;RAS-like, family 10, member A;RASL10A;RAS-like, family 10, member A |
Definition | RAS-related on chromosome 22|ras-like protein RRP22|ras-like protein family member 10A|ras-related protein on chromosome 22 |
Position | 22q12.2 |
Gene Type | protein-coding |
Source | Count: 2; Generif,UniProt |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | RRP22 localizes to the nucleolus in a GTP-dependent manner and can serve as a potential tumor suppressor. |
| More detail of all 1 literatures about RASL10A | |
|
External Links |
|
Links to Entrez Gene | 10633 |
Links to all GeneRIF Items | 10633 |
Links to iHOP | 10633 |
|
Sequence Information |
|
Nucleotide Sequence |
>10633 : length: 348 atggggggtagcctgcgggtggccgttctaggcgccccgggcgtgggcaagacggccatc atccgccagttcctgttcggtgactaccccgagcgccaccggcccacggacgggccgcgc ctctaccgacccgcggtgctgctcgacggcgccgtctacgacttgagcatccgcgacggc gacgtcgctggccccggctcgagccccgggggtccggaggagtggccagacgctaaggac tggagcttgcaggacacggacgccttcgtgctcgtctacgacatctgcagcccggacagt ttcgactacgtgaaggccctgcggcagcgcatcgcggagaccaggtag |
Protein Sequence |
>10633 : length: 115 MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDG DVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETR |