|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10641 |
Name | NPRL2 |
Synonym | NPR2|NPR2L|TUSC4;nitrogen permease regulator-like 2 (S. cerevisiae);NPRL2;nitrogen permease regulator-like 2 (S. cerevisiae) |
Definition | 2810446G01Rik|G21 protein|NPR2-like protein|gene 21 protein|homologous to yeast nitrogen permease (candidate tumor suppressor)|nitrogen permease regulator 2-like protein|tumor suppressor candidate 4 |
Position | 3p21.3 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
potential | The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 tumor suppressor Gene Consortium. |
reviewed | "tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A are downregulated in primary non-small cell lung cancer". |
reviewed | "Npr2, yeast homolog of the human tumor suppressor NPRL2, is a target of Grr1 required for adaptation to growth on diverse nitrogen sources." |
reviewed | The tumor suppressor NPRL2 in hepatocellular carcinoma plays an important role in progression and can be served as an independent prognostic factor. |
reviewed | The 3p21.3 tumor suppressor NPRL2 plays an important role in cisplatin-induced resistance in human non-small-cell lung cancer cells. |
reviewed | NPRL2 is a multiple tumor suppressor gene. |
reviewed | Expression of several genes in the human chromosome 3p21.3 homozygous deletion region by an adenovirus vector results in tumor suppressor activities in vitro and in vivo. |
| More detail of all 7 literatures about NPRL2 | |
|
External Links |
|
Links to Entrez Gene | 10641 |
Links to all GeneRIF Items | 10641 |
Links to iHOP | 10641 |
|
Sequence Information |
|
Nucleotide Sequence |
>10641 : length: 1143 atgggcagcggctgccgcatcgaatgcatattcttcagcgagttccaccccacgctggga cccaagatcacctatcaggtccctgaagacttcatctcccgagagctgtttgacacagtc caagtgtacatcatcaccaagccagagctgcagaacaagcttatcactgtcacagctatg gaaaagaagctgatcggctgtcctgtgtgcatcgaacacaagaagtacagccgcaatgct ctcctcttcaacctgggcttcgtgtgtgatgcccaggccaagacctgcgccctcgagccc attgttaaaaagctggctggctatctgaccacactagagctagagagcagcttcgtgtcc atggaggagagcaagcagaagttggtgcccatcatgaccatcttgctggaggagctaaat gcctcaggccggtgcactctgcccattgatgagtccaacaccatccacttgaaggtgatt gagcagcggccagaccctccggtggcccaggagtatgatgtacctgtctttaccaaagac aaggaggatttcttcaactcacagtgggacctcactacacaacaaatcctgccctacatt gatgggttccgccacatccagaagatttcagcagaggcagatgtggagctcaacctggtg cgcattgctatccagaacctgctgtactacggcgttgtgacactggtgtccatcctccag tactccaatgtatactgcccaacgcccaaggtccaggacctggtagatgacaagtccctg caagaggcatgtctatcctacgtgaccaagcaagggcacaagagggccagtctccgggat gtgttccagctatactgcagcctgagccctggcactaccgtgcgagacctcattggccgc cacccccagcagctgcagcatgttgatgaacggaagctgatccagttcgggcttatgaag aacctcatcaggcgactacagaagtatcctgtgcgggtgactcgggaagagcagagccac cctgcccggctttatacaggctgccacagctatgacgagatctgctgcaagacaggcatg agctaccatgagctggatgagcggcttgaaaatgaccccaacatcatcatctgctggaag tga |
Protein Sequence |
>10641 : length: 380 MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM EKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFVS MEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKD KEDFFNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQ YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGR HPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGM SYHELDERLENDPNIIICWK |