|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 10653 |
Name | SPINT2 |
Synonym | DIAR3|HAI-2|HAI2|Kop|PB;serine peptidase inhibitor, Kunitz type, 2;SPINT2;serine peptidase inhibitor, Kunitz type, 2 |
Definition | hepatocyte growth factor activator inhibitor type 2|kunitz-type protease inhibitor 2|placental bikunin|serine protease inhibitor, Kunitz type, 2 |
Position | 19q13.1 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status | Description |
reviewed | Epigenetic inactivation and tumor suppressor activity of HAI-2/SPINT2 in gastric cancer. |
potential | data support the role of SPINT2 as a putative tumor suppressor gene in medulloblastoma and further implicate dysregulation of the HGF/MET signaling pathway in the pathogenesis of medulloblastoma. |
| More detail of all 2 literatures about SPINT2 | |
External Links | |
Links to Entrez Gene | 10653 |
Links to all GeneRIF Items | 10653 |
Links to iHOP | 10653 |
Sequence Information | |
Nucleotide Sequence | >10653 : length: 588 atggcgcagctgtgcgggctgaggcggagccgggcgtttctcgccctgctgggatcgctg ctcctctctggggtcctggcggccgaccgagaacgcagcatccacgagaatgccacgggt gacctggccaccagcaggaatgcagcggattcctctgtcccaagtgctcccagaaggcag gattctgaagaccactccagcgatatgttcaactatgaagaatactgcaccgccaacgca gtcactgggccttgccgtgcatccttcccacgctggtactttgacgtggagaggaactcc tgcaataacttcatctatggaggctgccggggcaataagaacagctaccgctctgaggag gcctgcatgctccgctgcttccgccagcaggagaatcctcccctgccccttggctcaaag gtggtggttctggcggggctgttcgtgatggtgttgatcctcttcctgggagcctccatg gtctacctgatccgggtggcacggaggaaccaggagcgtgccctgcgcaccgtctggagc tccggagatgacaaggagcagctggtgaagaacacatatgtcctgtga |
Protein Sequence | >10653 : length: 195 MAQLCGLRRSRAFLALLGSLLLSGVLAADRERSIHENATGDLATSRNAADSSVPSAPRRQ DSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEE ACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWS SGDDKEQLVKNTYVL |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |