|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10904 |
Name | BLCAP |
Synonym | BC10;bladder cancer associated protein;BLCAP;bladder cancer associated protein |
Definition | bladder cancer 10 kDa protein|bladder cancer related protein (10kD)|bladder cancer-associated protein |
Position | 20q11.23 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | might be a potential tumor suppressor gene in cervical carcinoma. |
| More detail of all 1 literatures about BLCAP | |
|
External Links |
|
Links to Entrez Gene | 10904 |
Links to all GeneRIF Items | 10904 |
Links to iHOP | 10904 |
|
Sequence Information |
|
Nucleotide Sequence |
>10904 : length: 264 atgtattgcctccagtggctgctgcccgtcctcctcatccccaagcccctcaaccccgcc ctgtggttcagccactccatgttcatgggcttctacctgctcagcttcctcctggaacgg aagccttgcacaatttgtgccttggttttcctggcagccctgttccttatctgctatagc tgctggggaaactgtttcctgtaccactgctccgattccccgcttccagaatcggcgcat gatcccggcgttgtgggcacctaa |
Protein Sequence |
>10904 : length: 87 MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT |