|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10912 |
Name | GADD45G |
Synonym | CR6|DDIT2|GADD45gamma|GRP17;growth arrest and DNA-damage-inducible, gamma;GADD45G;growth arrest and DNA-damage-inducible, gamma |
Definition | DDIT-2|DNA damage-inducible transcript 2 protein|GADD45-gamma|cytokine-responsive protein CR6|gadd-related protein, 17 kD|growth arrest and DNA damage-inducible protein GADD45 gamma |
Position | 9q22.1-q22.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | Results show that GADD45G can act as a functional new-age tumor suppressor but being frequently inactivated epigenetically in multiple tumors. |
| More detail of all 1 literatures about GADD45G | |
|
Pathways and Diseases |
|
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Disease | Pituitary tumor;FunDO |
Disease | Liver cancer;FunDO |
Disease | protein quantitative trait loci;GAD |
Disease | Protein quantitative trait loci;NHGRI |
|
External Links |
|
Links to Entrez Gene | 10912 |
Links to all GeneRIF Items | 10912 |
Links to iHOP | 10912 |
|
Sequence Information |
|
Nucleotide Sequence |
>10912 : length: 480 atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag ggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcact gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt gtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctg atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga |
Protein Sequence |
>10912 : length: 159 MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |