|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11009 |
Name | IL24 |
Synonym | C49A|FISP|IL10B|MDA7|MOB5|ST16;interleukin 24;IL24;interleukin 24 |
Definition | IL-4-induced secreted protein|interleukin-24|melanocyte-associated Mda-7|melanoma differentiation-associated gene 7 protein|suppression of tumorigenicity 16 (melanoma differentiation) |
Position | 1q32 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 5 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "MDA-7/IL-24, a novel tumor suppressor/cytokine is ubiquitinated and regulated by the ubiquitin-proteasome system, and inhibition of MDA-7/IL-24 degradation enhances the antitumor activity." |
reviewed | tumor suppressor MDA-7/IL-24 selectively inhibits vascular smooth muscle cell growth and migration. |
reviewed | study demonstrate that expression of the MDA-7 tumor suppressor can negatively regulate iNOS expression in malignant melanoma cell lines. |
reviewed | "The protein product of the tumor suppressor gene, melanoma differentiation-associated gene 7, exhibits immunostimulatory activity and is designated IL-24." |
potential | "Grp170 enhances therapeutic activity of a novel tumor suppressor, mda-7/IL-24". |
| More detail of all 5 literatures about IL24 | |
|
Pathways and Diseases |
|
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Disease | Dermatitis;FunDO |
Disease | palmoplanta pustulosis;GAD |
Disease | Adenovirus infection;FunDO |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Metastatic Melanoma;GAD |
|
External Links |
|
Links to Entrez Gene | 11009 |
Links to all GeneRIF Items | 11009 |
Links to iHOP | 11009 |
|
Sequence Information |
|
Nucleotide Sequence |
>11009 : length: 624 atgaattttcaacagaggctgcaaagcctgtggactttagccagcagacccttctgccct cctttgctggcgacagcctctcaaatgcagatggttgtgctcccttgcctgggttttacc ctgcttctctggagccaggtatcaggggcccagggccaagaattccactttgggccctgc caagtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacact atgcaagctcaggataacatcacgagtgcccggctgctgcagcaggaggttctgcagaac gtctcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaact gttttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctact ctggccaacaactttgttctcatcgtgtcacaactgcaacccagtcaagaaaatgagatg ttttccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacag ttggacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctgg atgcagaaattctacaagctctga |
Protein Sequence |
>11009 : length: 207 MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPC QVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKT VFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQ LDVEAALTKALGEVDILLTWMQKFYKL |