|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11010 |
Name | GLIPR1 |
Synonym | CRISP7|GLIPR|RTVP1;GLI pathogenesis-related 1;GLIPR1;GLI pathogenesis-related 1 |
Definition | GLI pathogenesis-related 1 (glioma)|gliPR 1|glioma pathogenesis-related protein 1|protein RTVP-1|related to testis-specific, vespid, and pathogenesis proteins 1|testes-specific vespid and pathogenesis protein 1 |
Position | 12q21.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Identification of GLIPR1 tumor suppressor as methylation-silenced gene in acute myeloid leukemia by microarray analysis. |
potential | GLIPR1 is a proapoptotic tumor suppressor acting through the ROS-JNK pathway. |
reviewed | "RTVP-1, a tumor suppressor inactivated by methylation in prostate cancer." |
| More detail of all 3 literatures about GLIPR1 | |
|
Pathways and Diseases |
|
Pathway | Metabolism of lipids and lipoproteins;Reactome;REACT:22258 |
Disease | Brain tumor;FunDO |
Disease | Prostate cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 11010 |
Links to all GeneRIF Items | 11010 |
Links to iHOP | 11010 |
|
Sequence Information |
|
Nucleotide Sequence |
>11010 : length: 801 atgcgtgtcacacttgctacaatagcctggatggtttcttttgtctccaattattcacac acagcaaatattttgccagatatcgaaaatgaagatttcatcaaagactgcgttcgaatc cataacaagttccgatcagaggtgaaaccaacagccagtgatatgctatacatgacttgg gacccagcactagcccaaattgcaaaagcatgggccagcaattgccagttttcacataat acacggctgaagccaccccacaagctgcacccaaacttcacttcactgggagagaacatc tggactgggtctgtgcccattttttctgtgtcttccgccatcacaaactggtatgacgaa atccaggactatgacttcaagactcggatatgcaaaaaagtctgtggccactacactcag gttgtttgggcagatagttacaaagttggctgcgcagttcaattttgccctaaagtttct ggctttgacgctctttccaatggagcacattttatatgcaactacggaccaggagggaat tacccaacttggccatataagagaggagccacctgcagtgcctgccccaataatgacaag tgtttggacaatctctgtgttaaccgacagcgagaccaagtcaaacgttactactctgtt gtatatccaggctggcccatatatccacgtaacagatacacttctctctttctcattgtt aattcagtaattctaatactgtctgttataattaccattttggtacagcacaagtaccct aatttagttcttttggactaa |
Protein Sequence |
>11010 : length: 266 MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTW DPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDE IQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGN YPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV NSVILILSVIITILVQHKYPNLVLLD |