|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11068 |
Name | CYB561D2 |
Synonym | 101F6|TSP10;cytochrome b-561 domain containing 2;CYB561D2;cytochrome b-561 domain containing 2 |
Definition | cytochrome b561 domain-containing protein 2|putative tumor suppressor 101F6|putative tumor suppressor protein 101F6 |
Position | 3p21.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Spectral characterization of the recombinant mouse tumor suppressor 101F6 protein. |
potential | "The protein exhibits the characteristics typical of members of the cytochrome b561 family, being a hydrophobic, transmembrane heme protein. It is capable of oxidation-reduction reaction and is a candidate tumor suppressor gene product." |
| More detail of all 2 literatures about CYB561D2 | |
|
External Links |
|
Links to Entrez Gene | 11068 |
Links to all GeneRIF Items | 11068 |
Links to iHOP | 11068 |
|
Sequence Information |
|
Nucleotide Sequence |
>11068 : length: 669 atggccctttctgcggagaccgagtcacacatctaccgagctctgcgtactgcttctggc gctgccgcccaccttgtggccctgggctttaccatctttgtggctgtgcttgccaggcct ggctccagcctgttctcctggcacccggtgcttatgtctttggctttctccttcctgatg accgaggcactactggtgttttctcctgagagttcgctgctgcactccctctcacggaaa ggccgagcacgctgccactgggtgctgcagctgctggccctgctgtgtgcactgctgggc ctcggccttgtcatcctccacaaagagcagcttggcaaagcccacctggttacgcggcat gggcaggcagggctgctggctgtgctgtgggcagggctgcagtgctcaggtggggtgggg ctgctctaccccaagctgctgccccgatggcccctggcgaagctcaagctataccatgct acttctgggctggtgggctacctgctgggtagtgccagcctcttgctgggcatgtgctca ctctggttcactgcctctgtcactggtgcagcctggtacctggctgtattatgccctgtc ctcaccagcttggtcattatgaaccaggtgagcaatgcctacctataccgcaagaggatc caaccatga |
Protein Sequence |
>11068 : length: 222 MALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLM TEALLVFSPESSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLVTRH GQAGLLAVLWAGLQCSGGVGLLYPKLLPRWPLAKLKLYHATSGLVGYLLGSASLLLGMCS LWFTASVTGAAWYLAVLCPVLTSLVIMNQVSNAYLYRKRIQP |