|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11145 |
Name | PLA2G16 |
Synonym | AdPLA|H-REV107-1|HRASLS3|HREV107|HREV107-1|HREV107-3|HRSL3;phospholipase A2, group XVI;PLA2G16;phospholipase A2, group XVI |
Definition | Ca-independent phospholipase A1/2|H-rev 107 protein homolog|HRAS-like suppressor 1|HRAS-like suppressor 3|adipose-specific PLA2|adipose-specific phospholipase A2|group XVI phospholipase A2|renal carcinoma antigen NY-REN-65 |
Position | 11q12.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Growth-inhibitory activity and downregulation of the class II tumor-suppressor gene H-rev107 in tumor cell lines and experimental tumors. |
reviewed | "hH-Rev107, a class II tumor suppressor gene, is expressed by post-meiotic testicular germ cells and CIS cells but not by human testicular germ cell tumors." |
reviewed | Regulation of peroxisomal lipid metabolism by catalytic activity of tumor suppressor H-rev107. |
reviewed | Silencing of the mouse H-rev107 gene encoding a class II tumor suppressor by CpG methylation. |
reviewed | Murine H-rev107 gene encoding a class II tumor suppressor: gene organization and identification of an Sp1/Sp3-binding GC-box required for its transcription. |
potential | role of PKC isoenzymes in PP2A and HRSL3(H-REV107-1) tumor suppressor-dependent cell death induction in ovarian carcinoma cell line; verified contribution to PP2A- and HRLS3-dependent apoptosis for PKCzeta suggesting a proapoptotic function of this kinase. |
reviewed | Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells. |
| More detail of all 7 literatures about PLA2G16 | |
|
Pathways and Diseases |
|
Pathway | phospholipases;BioCyc;LIPASYN-PWY |
Disease | Lung cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 11145 |
Links to all GeneRIF Items | 11145 |
Links to iHOP | 11145 |
|
Sequence Information |
|
Nucleotide Sequence |
>11145 : length: 489 atgcgtgcgcccattccagagcctaagcctggagacctgattgagatttttcgccctttc tacagacactgggccatctatgttggcgatggatatgtggttcatctggcccctccaagt gaggtcgcaggagctggtgcagccagtgtcatgtccgccctgactgacaaggccatcgtg aagaaggaattgctgtatgatgtggccgggagtgacaagtaccaggtcaacaacaaacat gatgacaagtactcgccgctgccctgcagcaaaatcatccagcgggcggaggagctggtg gggcaggaggtgctctacaagctgaccagtgagaactgcgagcactttgtgaatgagctg cgctatggagtcgcccgcagtgaccaggtcagagatgtcatcatcgctgcaagcgttgca ggaatgggcttggcagccatgagccttattggagtcatgttctcaagaaacaagcgacaa aagcaataa |
Protein Sequence |
>11145 : length: 162 MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL RYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ |