|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 11186 |
Name | RASSF1 |
Synonym | 123F2|NORE2A|RASSF1A|RDA32|REH3P21;Ras association (RalGDS/AF-6) domain family member 1;RASSF1;Ras association (RalGDS/AF-6) domain family member 1 |
Definition | WUGSC:H_LUCA12.5|cardiac-specific ras association domain family 1 protein|pancreas-specific ras association domain family 1 protein|ras association domain-containing protein 1|tumor suppressor protein RDA32 |
Position | 3p21.3 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 69 PubMed records as below. |
Evidence Status | Description |
reviewed | Effect of zinc supplementation on N-nitrosomethylbenzylamine-induced forestomach tumor development and progression in tumor suppressor-deficient mouse strains. |
reviewed | tumor suppressor Ras-association domain family 1 isoform A is a novel regulator of cardiac hypertrophy. |
reviewed | RASSF1A is part of a complex similar to the Drosophila Hippo/Salvador/Lats tumor-suppressor network. |
reviewed | Involvement of the RASSF1A tumor suppressor gene in controlling cell migration. |
reviewed | Rassf1A acts as a tumor suppressor gene. |
potential | Specificity of the methylation-suppressed A isoform of candidate tumor suppressor RASSF1 for microtubule hyperstabilization is determined by cell death inducer C19ORF5. |
potential | RASSF3 and NORE1: identification and cloning of two human homologues of the putative tumor suppressor gene RASSF1. |
potential | The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 tumor suppressor Gene Consortium. |
reviewed | Evidence of epigenetic regulation of the tumor suppressor gene cluster flanking RASSF1 in breast cancer cell lines. |
reviewed | a role for Salvador as a human tumor suppressor and RASSF1A effector and show that Salvador allows RASSF1A to modulate p73 independently of the hippo pathway. |
| More detail of all 69 literatures about RASSF1 | |
Pathways and Diseases | |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | p53 pathway;PID Curated;200175 |
Disease | Pre-Eclampsia;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | esophageal cancer;GAD |
Disease | Non-small cell lung cancer;KEGG DISEASE;H00014 |
Disease | Lung cancer;OMIM |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | breast cancer;GAD |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Infection;FunDO |
Disease | head and neck cancer;GAD |
Disease | Obesity;FunDO |
Disease | Nasopharyngeal cancer;KEGG DISEASE;H00054 |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | lung cancer;GAD |
Disease | Head and neck cancers;KEGG DISEASE |
Disease | Bladder cancer;KEGG DISEASE;H00022 |
Disease | colorectal cancer;GAD |
External Links | |
Links to Entrez Gene | 11186 |
Links to all GeneRIF Items | 11186 |
Links to iHOP | 11186 |
Sequence Information | |
Nucleotide Sequence | >11186 : length: 1023 atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg aagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctgcctggac tgttgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggac gagcctgtggagtgggagacacctgacctttctcaagctgagattgagcagaagatcaag gagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaaggacggttcttac acaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtgccctccagcaag aagccaccctccttgcaggatgcccggcggggcccaggacggggcacaagtgtcaggcgc cgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtgctgtcacgcaca agggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtggatgacccccgc aagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttgcggaagctgttg gatgatgagcagcccctgcggctgcggctcctggcagggcccagtgacaaggccctgagc tttgtcctgaaggaaaatgactctggggaggtgaactgggacgccttcagcatgcctgaa ctacataacttcctacgtatcctgcagcgggaggaggaggagcacctccgccagatcctg cagaagtactcctattgccgccagaagatccaagaggccctgcacgcctgcccccttggg tga |
Protein Sequence | >11186 : length: 340 MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVD EPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK KPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR KFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPE LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG |