|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11197 |
Name | WIF1 |
Synonym | WIF-1;WNT inhibitory factor 1;WIF1;WNT inhibitory factor 1 |
Definition | wnt inhibitory factor 1 |
Position | 12q14.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | the WIF-1 is downregulated by promoter methylation and functions as a tumor suppressor gene by inducing apoptosis in human renal cell carcinoma cells. |
potential | analyzed 5 osteosarcoma cell lines in a high-throughput screen for epigenetically silenced tumor suppressor genes and identified Wnt inhibitory factor 1 (WIF1) as a candidate tumor suppressor gene. |
reviewed | "WIF1 may be a tumor suppressor, specifically in nonfunctioning pituitary tumors, and that the Wnt pathways are important in pituitary tumorigenesis." |
reviewed | "Thus, WIF1 functions as a tumor suppressor for both NPC and ESCC through suppressing the Wnt-signaling pathway, but is frequently silenced by epigenetic mechanism in a tumor-specific way." |
| More detail of all 4 literatures about WIF1 | |
|
Pathways and Diseases |
|
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152 |
Pathway | wnt signaling pathway;PID BioCarta;100002 |
Pathway | Presenilin action in Notch and Wnt signaling;PID Curated;200052 |
Pathway | multi-step regulation of transcription by pitx2;PID BioCarta;100074 |
Pathway | Wnt signaling network;PID Curated;200055 |
Pathway | segmentation clock;PID BioCarta;100146 |
Disease | Barrett's esophagus;FunDO |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 11197 |
Links to all GeneRIF Items | 11197 |
Links to iHOP | 11197 |
|
Sequence Information |
|
Nucleotide Sequence |
>11197 : length: 1140 atggcccggaggagcgccttccctgccgccgcgctctggctctggagcatcctcctgtgc ctgctggcactgcgggcggaggccgggccgccgcaggaggagagcctgtacctatggatc gatgctcaccaggcaagagtactcataggatttgaagaagatatcctgattgtttcagag gggaaaatggcaccttttacacatgatttcagaaaagcacaacagagaatgccagctatt cctgtcaatatccattccatgaattttacctggcaagctgcagggcaggcagaatacttc tatgaattcctgtccttgcgctccctggataaaggcatcatggcagatccaaccgtcaat gtccctctgctgggaacagtgcctcacaaggcatcagttgttcaagttggtttcccatgt cttggaaaacaggatggggtggcagcatttgaagtggatgtgattgttatgaattctgaa ggcaacaccattctccaaacacctcaaaatgctatcttctttaaaacatgtcaacaagct gagtgcccaggcgggtgccgaaatggaggcttttgtaatgaaagacgcatctgcgagtgt cctgatgggttccacggacctcactgtgagaaagccctttgtaccccacgatgtatgaat ggtggactttgtgtgactcctggtttctgcatctgcccacctggattctatggagtgaac tgtgacaaagcaaactgctcaaccacctgctttaatggagggacctgtttctaccctgga aaatgtatttgccctccaggactagagggagagcagtgtgaaatcagcaaatgcccacaa ccctgtcgaaatggaggtaaatgcattggtaaaagcaaatgtaagtgttccaaaggttac cagggagacctctgttcaaagcctgtctgcgagcctggctgtggtgcacatggaacctgc catgaacccaacaaatgccaatgtcaagaaggttggcatggaagacactgcaataaaagg tacgaagccagcctcatacatgccctgaggccagcaggcgcccagctcaggcagcacacg ccttcacttaaaaaggccgaggagcggcgggatccacctgaatccaattacatctggtga |
Protein Sequence |
>11197 : length: 379 MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQA ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHT PSLKKAEERRDPPESNYIW |