|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 112464 |
Name | PRKCDBP |
Synonym | CAVIN3|HSRBC|SRBC|cavin-3;protein kinase C, delta binding protein;PRKCDBP;protein kinase C, delta binding protein |
Definition | protein kinase C delta-binding protein|sdr-related gene product that binds to c-kinase|serum deprivation response factor-related gene product that binds to C-kinase |
Position | 11p15.4 |
Gene Type | protein-coding |
Source | Count: 2; Generif,UniProt |
Literature support | Count: 3 PubMed records as below. |
Evidence Status | Description |
reviewed | "hSRBC is a novel tumor suppressor whose epigenetic inactivation contributes to the malignant progression of gastric tumors, in part, through attenuated p53 response to stresses." |
potential | "hSRBC is a candidate tumor suppressor gene involved in lung cancer pathogenesis, where expression is frequently inactivated by methylation and other mechanisms". |
reviewed | Human SRBC is located within the 11p15.5-p15.4 tumor suppressor region and is inactivated in breast and lung cancers. |
| More detail of all 3 literatures about PRKCDBP | |
External Links | |
Links to Entrez Gene | 112464 |
Links to all GeneRIF Items | 112464 |
Links to iHOP | 112464 |
Sequence Information | |
Nucleotide Sequence | >112464 : length: 786 atgagggagagtgcgttggagcgggggcctgtgcccgaggcgccggcggggggtcccgtg cacgccgtgacggtggtgaccctgctggagaagctggcctccatgctggagactctgcgg gagcggcagggaggcctggctcgaaggcagggaggcctggcagggtccgtgcgccgcatc cagagcggcctgggcgctctgagtcgcagccacgacaccaccagcaacaccttggcgcag ctgctggccaaggcggagcgcgtgagctcgcacgccaacgccgcccaagagcgcgcggtg cgccgcgcagcccaggtgcagcggctggaggccaaccacgggctgctggtggcgcgcggg aagctccacgttctgctcttcaaggaggagggtgaagtcccagccagcgctttccagaag gcaccagagcccttgggcccggcggaccagtccgagctgggcccagagcagctggaggcc gaagttggagagagctcggacgaggagccggtggagtccagggcccagcggctgcggcgc accggattgcagaaggtacagagcctccgaagggccctttcgggccggaaaggccctgca gcgccaccgcccaccccggtcaagccgcctcgccttgggcctggccggagcgctgaagcc cagccggaagcccagcctgcgctggagcccacgctggagccagagcctccgcaggacacc gaggaagatcccgggagacctggggctgccgaagaagctctgctccaaatggagagtgta gcctga |
Protein Sequence | >112464 : length: 261 MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRI QSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARG KLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRR TGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDT EEDPGRPGAAEEALLQMESVA |