|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11315 |
Name | PARK7 |
Synonym | DJ-1|DJ1;parkinson protein 7;PARK7;parkinson protein 7 |
Definition | Parkinson disease (autosomal recessive, early onset) 7|Parkinson disease protein 7|oncogene DJ1|protein DJ-1 |
Position | 1p36.23 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | The present study demonstrated that the survival of patients with astrocytomas was correlated with the nuclear DJ-1 status of the tumor. The DJ-1 molecule might therefore play an important role as a tumor suppressor in astrocytomas. |
reviewed | "DJ-1, a novel regulator of the tumor suppressor PTEN." |
| More detail of all 2 literatures about PARK7 | |
|
Pathways and Diseases |
|
Pathway | Parkinson's disease;KEGG PATHWAY;hsa05012 |
Pathway | Alpha-synuclein signaling;PID Curated;200187 |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Parkinson's disease;KEGG DISEASE;H00057 |
Disease | Embryoma;FunDO |
Disease | Celiac Disease;GAD |
Disease | IMMUNE;GAD |
Disease | Amyotrophic lateral sclerosis-Parkinsonism/dementia complex 2;OMIM |
Disease | Neurodegenerative disorder;FunDO |
Disease | Polyneuropathy;FunDO |
Disease | Parkinson disease 7, autosomal recessive early-onset;OMIM |
Disease | Thyroid cancer;FunDO |
Disease | Intraocular melanoma;FunDO |
Disease | Amyloidosis;FunDO |
Disease | Nervous system diseases;KEGG DISEASE |
Disease | Neurodegenerative diseases;KEGG DISEASE |
Disease | Celiac disease;NHGRI |
Disease | Malignant glioma;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Parkinson disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 11315 |
Links to all GeneRIF Items | 11315 |
Links to iHOP | 11315 |
|
Sequence Information |
|
Nucleotide Sequence |
>11315 : length: 570 atggcttccaaaagagctctggtcatcctggctaaaggagcagaggaaatggagacggtc atccctgtagatgtcatgaggcgagctgggattaaggtcaccgttgcaggcctggctgga aaagacccagtacagtgtagccgtgatgtggtcatttgtcctgatgccagccttgaagat gcaaaaaaagagggaccatatgatgtggtggttctaccaggaggtaatctgggcgcacag aatttatctgagtctgctgctgtgaaggagatactgaaggagcaggaaaaccggaagggc ctgatagccgccatctgtgcaggtcctactgctctgttggctcatgaaataggttttgga agtaaagttacaacacaccctcttgctaaagacaaaatgatgaatggaggtcattacacc tactctgagaatcgtgtggaaaaagacggcctgattcttacaagccgggggcctgggacc agcttcgagtttgcgcttgcaattgttgaagccctgaatggcaaggaggtggcggctcaa gtgaaggctccacttgttcttaaagactag |
Protein Sequence |
>11315 : length: 189 MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ VKAPLVLKD |