|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11337 |
Name | GABARAP |
Synonym | ATG8A|MM46;GABA(A) receptor-associated protein;GABARAP;GABA(A) receptor-associated protein |
Definition | gamma-aminobutyric acid receptor-associated protein |
Position | 17p13.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | GABARAP mRNA expression and protein expression were significantly down-regulated in invasive ductal and invasive lobular carcinomas; GABARAP acts via a vesicle transport mechanism as a tumor suppressor in breast cancer. |
| More detail of all 1 literatures about GABARAP | |
|
Pathways and Diseases |
|
Pathway | gamma-aminobutyric acid receptor life cycle pathway;PID BioCarta;100158 |
Pathway | Regulation of autophagy;KEGG PATHWAY;hsa04140 |
Disease | Breast cancer;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | nicotine dependence;GAD |
|
External Links |
|
Links to Entrez Gene | 11337 |
Links to all GeneRIF Items | 11337 |
Links to iHOP | 11337 |
|
Sequence Information |
|
Nucleotide Sequence |
>11337 : length: 354 atgaagttcgtgtacaaagaagagcatccgttcgagaagcgccgctctgagggcgagaag atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc aacaatgtcattccacccaccagtgccacaatgggtcagctgtaccaggaacaccatgaa gaagacttctttctctacattgcctacagtgacgaaagtgtctacggtctgtga |
Protein Sequence |
>11337 : length: 117 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |