|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 115761 |
Name | ARL11 |
Synonym | ARLTS1;ADP-ribosylation factor-like 11;ARL11;ADP-ribosylation factor-like 11 |
Definition | ADP-ribosylation factor-like protein 11|ADP-ribosylation factor-like tumor suppressor protein 1 |
Position | 13q14.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "The role of the allelic variants in ARLTS1, RAD51 and MDM2 acting in the tumor suppressor, DNA repair and p53 pathways as risk factors for familial breast cancer in 147 patients displaying characteristics of familial disease, was investigated." |
reviewed | A novel tumor suppressor gene [ARLTS1 (ADP-ribosylation factor-like tumor suppressor gene 1)]is found to be altered in human carcinogenesis. It is located in Chromosome 13q14.3. |
reviewed | tumor suppressor functions of ARLTS1 in lung cancers. |
| More detail of all 3 literatures about ARL11 | |
|
External Links |
|
Links to Entrez Gene | 115761 |
Links to all GeneRIF Items | 115761 |
Links to iHOP | 115761 |
|
Sequence Information |
|
Nucleotide Sequence |
>115761 : length: 591 atgggttctgtgaattccagaggtcacaaggcggaagcccaggtggtgatgatgggcctg gactcggcgggcaagaccacgctcctttacaagctgaagggccaccagctggtggagacc ctgcccactgttggtttcaacgtggagcctctgaaagctcctgggcacgtgtcactgact ctctgggacgttggggggcaggccccgctcagagccagctggaaggactatctggaaggc acagatatcctcgtgtacgtgctggacagcacagatgaagcccgcttacccgagtcggcg gctgagctcacagaagtcctgaacgaccccaacatggctggcgtccccttcttggtgctg gccaacaagcaggaggcacctgatgcacttccgctgcttaagatcagaaacaggctgagt ctagagagattccaggaccactgctgggagctccggggctgcagtgccctcactggggag gggctgcccgaggccctgcagagcctgtggagcctcctgaaatctcgcagctgcatgtgt ctgcaggcgagagcccatggggctgagcgcggagacagcaagagatcttga |
Protein Sequence |
>115761 : length: 196 MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLT LWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVL ANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMC LQARAHGAERGDSKRS |