|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 116135 |
Name | LRRC3B |
Synonym | LRP15;leucine rich repeat containing 3B;LRRC3B;leucine rich repeat containing 3B |
Definition | leucine-rich repeat protein LRP15|leucine-rich repeat-containing protein 3B |
Position | 3p24 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | Methylation pattern of the putative tumor-suppressor gene LRRC3B promoter in clear cell renal cell carcinomas. |
potential | LRRC3B may be a novel methylation-sensitive tumor suppressor gene in CRC. LRRC3B methylation has significant tumor specificity and may be a biomarker of CRC. |
potential | suggest that LRRC3B is a putative tumor suppressor gene that is silenced in gastric cancers by epigenetic mechanisms and that LRRC3B silencing in cancer may play an important role in tumor escape from immune surveillance. |
| More detail of all 3 literatures about LRRC3B | |
|
External Links |
|
Links to Entrez Gene | 116135 |
Links to all GeneRIF Items | 116135 |
Links to iHOP | 116135 |
|
Sequence Information |
|
Nucleotide Sequence |
>116135 : length: 780 atgaatctggtagacctgtggttaacccgttccctctccatgtgtctcctcctacaaagt tttgttcttatgatactgtgctttcattctgccagtatgtgtcccaagggctgtctttgt tcttcctctgggggtttaaatgtcacctgtagcaatgcaaatctcaaggaaatacctaga gatcttcctcctgaaacagtcttactgtatctggactccaatcagatcacatctattccc aatgaaatttttaaggacctccatcaactgagagttctcaacctgtccaaaaatggcatt gagtttatcgatgagcatgccttcaaaggagtagctgaaaccttgcagactctggacttg tccgacaatcggattcaaagtgtgcacaaaaatgccttcaataacctgaaggccagggcc agaattgccaacaacccctggcactgcgactgtactctacagcaagttctgaggagcatg gcgtccaatcatgagacagcccacaacgtgatctgtaaaacgtccgtgttggatgaacat gctggcagaccattcctcaatgctgccaacgacgctgacctttgtaacctccctaaaaaa actaccgattatgccatgctggtcaccatgtttggctggttcactatggtgatctcatat gtggtatattatgtgaggcaaaatcaggaggatgcccggagacacctcgaatacttgaaa tccctgccaagcaggcagaagaaagcagatgaacctgatgatattagcactgtggtatag |
Protein Sequence |
>116135 : length: 259 MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPR DLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDL SDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEH AGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLK SLPSRQKKADEPDDISTVV |