|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 116173 |
Name | CMTM5 |
Synonym | CKLFSF5;CKLF-like MARVEL transmembrane domain containing 5;CMTM5;CKLF-like MARVEL transmembrane domain containing 5 |
Definition | CKLF-like MARVEL transmembrane domain-containing protein 5|chemokine-like factor super family 5|chemokine-like factor superfamily member 5 |
Position | 14q11.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "CMTM5 exhibits tumor suppressor activities, but with frequent epigenetic inactivation in carcinoma cell lines". |
| More detail of all 1 literatures about CMTM5 | |
|
External Links |
|
Links to Entrez Gene | 116173 |
Links to all GeneRIF Items | 116173 |
Links to iHOP | 116173 |
|
Sequence Information |
|
Nucleotide Sequence |
>116173 : length: 378 atgctcagtgctcgagatcgccgggaccggcaccctgaggagggggtagttgcagagctc cagggcttcgcggtggacaaggccttcctcacctcccacaagggcatcctgctggaaacc gagctggccctgaccctcatcatcttcatctgcttcacggcctccatctctgcctacatg gccgcggcgctactggagttcttcatcacacttgccttcctcttcctctatgccacccag tactaccagcgcttcgaccgaattaactggccctgtctggtttttggcatcatcctggtt tccatctttgcctatgatgccttcaagatctaccggactgagatggcacccggggccagc cagggggaccagcagtga |
Protein Sequence |
>116173 : length: 125 MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM AAALLEFFITLAFLFLYATQYYQRFDRINWPCLVFGIILVSIFAYDAFKIYRTEMAPGAS QGDQQ |