|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 117581 |
Name | TWIST2 |
Synonym | DERMO1|bHLHa39;twist homolog 2 (Drosophila);TWIST2;twist homolog 2 (Drosophila) |
Definition | class A basic helix-loop-helix protein 39|dermis-expressed protein 1|twist-related bHLH protein Dermo1|twist-related protein 2 |
Position | 2q37.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Our data implicate dermo1 as a tumor suppressor gene and a valuable molecular marker for human cancer. |
| More detail of all 1 literatures about TWIST2 | |
|
External Links |
|
Links to Entrez Gene | 117581 |
Links to all GeneRIF Items | 117581 |
Links to iHOP | 117581 |
|
Sequence Information |
|
Nucleotide Sequence |
>117581 : length: 483 atggaggagggctccagctcgcccgtgtcccccgtggacagcctgggcaccagcgaggag gagctcgagaggcagcccaagcgcttcggccggaagcggcgctacagcaagaagtcgagc gaagatggcagcccgaccccgggcaagcgcggcaagaagggcagccccagcgcgcagtcc ttcgaggagctgcagagccagcgcatcctggccaacgtgcgcgagcgccagcgcacccag tcgctcaacgaggccttcgcggcgctgcgcaagatcatccccacgctgccctctgacaag ctgagcaagatccagacgctcaagctggccgccaggtacatagacttcctctaccaggtc ctgcagagcgacgagatggacaataagatgaccagctgcagctacgtggcccacgagcgc ctcagctacgccttctccgtgtggcgcatggagggcgcgtggtccatgtccgcctcccac tag |
Protein Sequence |
>117581 : length: 160 MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQS FEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV LQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH |