|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 122953 |
Name | JDP2 |
Synonym | JUNDM2;Jun dimerization protein 2;JDP2;Jun dimerization protein 2 |
Definition | jun dimerization protein 2|progesterone receptor co-activator |
Position | 14q24.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | c-Jun dimerization protein 2 inhibits cell transformation and has a role as a tumor suppressor gene. |
potential | c-Jun dimerization protein 2 inhibits cell transformation and has a role as a tumor suppressor gene. |
More detail of all 1 literatures about JDP2 | |
Pathways and Diseases |
|
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
External Links |
|
Links to Entrez Gene | 122953 |
Links to all GeneRIF Items | 122953 |
Links to iHOP | 122953 |
Sequence Information |
|
Nucleotide Sequence |
>122953 : length: 492 atgatgcctgggcagatcccggacccttcggtgaccacaggctccctgccagggcttggc cccctgaccgggctccccagctcggccctgactgtggaggagctgaaatacgctgacatc cgcaacctcggggccatgattgcacccttgcacttcctggaggtgaaactgggcaagagg ccccagcccgtgaaaagtgagctagatgaggaagaggagcgaaggaaaaggcgccgggag aagaacaaagtcgcagcagcccgatgccggaacaagaagaaggagcgcacggagtttctg cagcgggaatccgagcggctggaactcatgaacgcagagctgaagacccagattgaggag ctgaagcaggagcggcagcagctcatcctgatgctgaaccgacaccgccccacctgcatc gtccggaccgacagtgtcaagacccccgagtcagaaggcaacccactgctcgagcagctc gagaagaagtga |
Protein Sequence |
>122953 : length: 163 MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE LKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |