|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 1316 |
Name | KLF6 |
Synonym | BCD1|CBA1|COPEB|CPBP|GBF|PAC1|ST12|ZF9;Kruppel-like factor 6;KLF6;Kruppel-like factor 6 |
Definition | B-cell-derived protein 1|GC-rich binding factor|GC-rich sites-binding factor GBF|Krueppel-like factor 6|Kruppel-like zinc finger protein Zf9|core promoter element binding protein|core promoter element-binding protein|proto-oncogene BCD1|protooncogene B-ce |
Position | 10p15 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 23 PubMed records as below. |
Evidence Status | Description |
reviewed | "Pituitary tumor transforming gene 1 (PTTG1), an oncogene, was the most up-regulated transcript in KLF6+/- liver. PTTG1 downregulation represents a novel tumor suppressor pathway of KLF6." |
reviewed | In vivo regulation of p21 by the Kruppel-like factor 6 tumor-suppressor gene in mouse liver and human hepatocellular carcinoma. |
reviewed | Deregulation of KLF6 stability may alter its tumor suppressor function and/or the response of tumors to chemotherapeutics. |
reviewed | Role of KLF6 tumor suppressor gene mutations in the development of colorectal carcinoma in an Egyptian population. |
reviewed | Energy restriction-mimetic agents induce apoptosis in prostate cancer cells in part through epigenetic activation of KLF6 tumor suppressor gene expression. |
reviewed | Nucleo-cytoplasmic localization domains regulate Krüppel-like factor 6 (KLF6) protein stability and tumor suppressor function. |
reviewed | "In melanoma cells, the tumor suppressor gene at 10p15 appears to be KLF6. Signaling from the collagen I-rich extracellular matrix appears to be involved in the tumor suppressive activity of KLF6 protein." |
reviewed | Nuclear expression of KLF6 tumor suppressor factor is highly associated with overexpression of ERBB2 oncoprotein in ductal breast carcinomas. |
reviewed | Our results demonstrate the induction of the tumor suppressor KLF6 following PKC activation and its importance for PMA-mediated cancer cell growth arrest. |
reviewed | Ras promotes growth by alternative splicing-mediated inactivation of the KLF6 tumor suppressor in hepatocellular carcinoma. |
| More detail of all 23 literatures about KLF6 | |
External Links | |
Links to Entrez Gene | 1316 |
Links to all GeneRIF Items | 1316 |
Links to iHOP | 1316 |
Sequence Information | |
Nucleotide Sequence | >1316 : length: 726 atggacgtgctccccatgtgcagcatcttccaggagctccagatcgtgcacgagaccggc tacttctcggcgctgccgtctctggaggagtactggcaacagacctgcctagagctggaa cgttacctccagagcgagccctgctatgtttcagcctcagaaatcaaatttgacagccag gaagatctgtggaccaaaatcattctggctcgggagaaaaaggaggaatccgaactgaag atatcttccagtcctccagaggacactctcatcagcccgagcttttgttacaacttagag accaacagcctgaactcagatgtcagcagcgaatcctctgacagctccgaggaactttct cccacggccaagtttacctccgaccccattggcgaagttttggtcagctcgggaaaattg agctcctctgtcacctccacgcctccatcttctccggaactgagcagggaaccttctcaa ctgtggggttgcgtgcccggggagctgccctcgccagggaaggtgcgcagcgggacttcg gggaagccaggagaaaagccttacagatgctcatgggaagggtgtgagtggcgttttgca agaagtgatgagttaaccaggcacttccgaaagcacaccggggccaagccttttaaatgc tcccactgtgacaggtgtttttccaggtctgaccacctggccctgcacatgaagaggcac ctctga |
Protein Sequence | >1316 : length: 241 MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQ EDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS PTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTS GKPGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRH L |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |