|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 135138 |
Name | PACRG |
Synonym | GLUP|HAK005771|PARK2CRG|RP3-495O10.2;PARK2 co-regulated;PACRG;PARK2 co-regulated |
Definition | molecular chaperone/chaperonin-binding protein|parkin co-regulated gene protein|parkin coregulated gene protein |
Position | 6q26 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | "candidate tumor suppressor genes PARK2 and PACRG are epigenetically regulated in human leukemia, suggesting that abnormal methylation and regulation of PARK2 and PACRG may play a role in the pathogenesis and development of this hematological neoplasm". |
More detail of all 1 literatures about PACRG | |
External Links |
|
Links to Entrez Gene | 135138 |
Links to all GeneRIF Items | 135138 |
Links to iHOP | 135138 |
Sequence Information |
|
Nucleotide Sequence |
>135138 : length: 774 atggtggcagaaaaagagaccctgagcttaaacaaatgcccagacaagatgccgaagagg accaagctgctggcacaacagccgctcccggtgcaccagcctcactctctggtttctgag ggtttcacagtcaaagccatgatgaaaaactcagtcgtgagaggccctccagctgcaggg gcatttaaagaaagaccaaccaagcccacagcatttcgaaaattctatgagcgaggtgac ttcccaattgcccttgagcatgattcgaaaggaaacaaaatcgcctggaaggtagaaatt gagaagctggattaccatcattatctgcctctgttttttgatgggctttgtgaaatgaca tttccctatgagttttttgctcggcaaggaatccacgacatgctggaacacggtgggaac aagatcctacctgtccttccacagctcattatcccgataaaaaatgccttgaacctccga aaccgacaggtcatctgtgtcactctcaaggtcctccagcatctggttgtgtcagctgag atggtgggcaaggccttggtgccttattaccgtcaaatcctccctgtcctgaacatcttt aagaatatgaatgtgaactccggagacggcattgactacagccagcagaagagggagaac attggggacttgatccaggagacactggaggccttcgagcgctacggaggagaaaatgcc tttatcaacattaagtacgtggtcccaacctacgagtcttgcttgctaaactaa |
Protein Sequence |
>135138 : length: 257 MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAG AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMT FPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAE MVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENA FINIKYVVPTYESCLLN |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |