|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1389 |
Name | CREBL2 |
Synonym | -;cAMP responsive element binding protein-like 2;CREBL2;cAMP responsive element binding protein-like 2 |
Definition | MHBs-binding protein 1|cAMP-responsive element-binding protein-like 2 |
Position | 12p13 |
Gene Type | protein-coding |
Source | Count: 1; UniProt |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about CREBL2 | |
|
External Links |
|
Links to Entrez Gene | 1389 |
Links to all GeneRIF Items | 1389 |
Links to iHOP | 1389 |
|
Sequence Information |
|
Nucleotide Sequence |
>1389 : length: 363 atggatgacagtaaggtggttggaggcaaagtaaagaagcccggtaaacgtggtcggaag ccagccaaaattgacttgaaagcaaaacttgagaggagccggcagagtgcaagagaatgc cgagcccgaaaaaagctgagatatcagtatttggaagagttggtatccagtcgagaaaga gctatatgtgccctcagagaggaactggaaatgtacaagcagtggtgcatggcaatggac caaggaaaaatcccttctgaaataaaggccctactcactggagaagagcagaacaaatct cagcagaactcaagcaggcataccaaggctgggaagacagatgctaatagcaattcctgg tga |
Protein Sequence |
>1389 : length: 120 MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER AICALREELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW |