|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 147040 |
Name | KCTD11 |
Synonym | C17orf36|KCASH1|REN|REN/KCTD11;potassium channel tetramerisation domain containing 11;KCTD11;potassium channel tetramerisation domain containing 11 |
Definition | BTB/POZ domain-containing protein KCTD11|potassium channel tetramerization domain containing 11|retinoic acid, EGF, NGF induced gene protein|retinoic acid, EGF, NGF induced gene/potassium channel tetramerization domain containing 11 |
Position | 17p13.1 |
Gene Type | protein-coding |
Source | Count: 1; UniProt |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about KCTD11 | |
|
External Links |
|
Links to Entrez Gene | 147040 |
Links to all GeneRIF Items | 147040 |
Links to iHOP | 147040 |
|
Sequence Information |
|
Nucleotide Sequence |
>147040 : length: 699 atgctgggggccatgtttagggccggcacccccatgccccccaacctcaattcccaagga ggcggccactacttcatcgaccgggatggcaaggccttccggcacatcctcaatttcctg aggctgggccgcctggacctgccccgtgggtacggagagacagcgctgctcagggcagag gctgacttctaccagatccggcccctcctggacgcgctgcgggaactggaggcctctcag gggacccctgcacccacagctgccctgctccacgcagatgtagatgtcagcccccgcctg gtgcacttctctgctcgccggggaccccatcactatgagctgagctccgtccaggtggac accttccgagccaaccttttctgcaccgactctgagtgtctaggtgctttgcgggcccga tttggtgtggccagtggggatagggcagaggggagcccacattttcatctggagtgggcc ccccgccccgtggaactccccgaggtggagtatgggagactggggctgcagccgctgtgg actggggggccaggagagcggcgggaggtggtgggcaccccaagcttcctggaggaggtg ctgcgggtggctctcgagcacggcttccgactagactctgtcttccccgaccccgaagac ctgctcaactccaggtctctgcgctttgtccggcactga |
Protein Sequence |
>147040 : length: 232 MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAE ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVD TFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLW TGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH |