|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1474 |
Name | CST6 |
Synonym | -;cystatin E/M;CST6;cystatin E/M |
Definition | cystatin 6|cystatin M|cystatin M/E|cystatin-6|cystatin-E|cystatin-M|cysteine proteinase inhibitor |
Position | 11q13 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
potential | cystatin M/E has a role in skin barrier formation and a potential role as a tumor suppressor gene [review]. |
potential | Cystatin m: a novel candidate tumor suppressor gene for breast cancer. |
reviewed | Cystatin M (CST6) tumor suppressor gene is concurrently down-regulated with other loci in breast epithelial cells cocultured with cancer-associated fibroblasts. |
reviewed | Inactivation of the cystatin E/M tumor suppressor gene in cervical cancer. |
potential | Cystatin M may encode a novel epigenetically inactivated candidate tumor suppressor gene. |
reviewed | Epigenetic silencing of the tumor suppressor cystatin M occurs during breast cancer progression. |
potential | "The candidate tumor suppressor CST6 alters the gene expression profile of human breast carcinoma cells: down-regulation of the potent mitogenic, motogenic, and angiogenic factor autotaxin." |
| More detail of all 7 literatures about CST6 | |
|
External Links |
|
Links to Entrez Gene | 1474 |
Links to all GeneRIF Items | 1474 |
Links to iHOP | 1474 |
|
Sequence Information |
|
Nucleotide Sequence |
>1474 : length: 450 atggcgcgttcgaacctcccgctggcgctgggcctggccctggtcgcattctgcctcctg gcgctgccacgcgacgcccgggcccggccgcaggagcgcatggtcggagaactccgggac ctgtcgcccgacgacccgcaggtgcagaaggcggcgcaggcggccgtggccagctacaac atgggcagcaacagcatctactacttccgagacacgcacatcatcaaggcgcagagccag ctggtggccggcatcaagtacttcctgacgatggagatggggagcacagactgccgcaag accagggtcactggagaccacgtcgacctcaccacttgccccctggcagcaggggcgcag caggagaagctgcgctgtgactttgaggtccttgtggttccctggcagaactcctctcag ctcctaaagcacaactgtgtgcagatgtga |
Protein Sequence |
>1474 : length: 149 MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYN MGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQ QEKLRCDFEVLVVPWQNSSQLLKHNCVQM |