|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 148252 |
Name | DIRAS1 |
Synonym | Di-Ras1|GBTS1|RIG;DIRAS family, GTP-binding RAS-like 1;DIRAS1;DIRAS family, GTP-binding RAS-like 1 |
Definition | GTP-binding protein Di-Ras1|distinct subgroup of the Ras family member 1|ras-related inhibitor of cell growth|small GTP-binding tumor suppressor 1 |
Position | 19p13.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | Rig a novel Ras-related protein and potential neural tumor suppressor (RIG). |
| More detail of all 1 literatures about DIRAS1 | |
|
External Links |
|
Links to Entrez Gene | 148252 |
Links to all GeneRIF Items | 148252 |
Links to iHOP | 148252 |
|
Sequence Information |
|
Nucleotide Sequence |
>148252 : length: 597 atgccggaacagagtaacgattaccgcgtggtggtgttcggggcgggcggcgtgggcaag agctcgctggtgctgcgcttcgtgaagggcacgttccgcgacacctacatccccaccatc gaggacacctaccggcaggtgatcagctgcgacaagagcgtgtgcacgctgcagatcaca gacaccaccggcagccaccagttcccggccatgcagcgcctgtccatctccaagggccac gccttcatcctggtgttctccgtcaccagcaagcagtcgctggaggagctggggcccatc tacaagctcatcgtgcagatcaagggcagcgtggaggacatccccgtgatgctcgtgggc aacaagtgcgatgagacgcagcgggaggtggacacgcgcgaggcgcaggcggtggcccag gagtggaagtgcgctttcatggagacctcggccaagatgaactacaacgtcaaggagctc ttccaggagctgctgacgctggagacgcgccggaacatgagcctcaacatcgacggcaag cgctccgggaagcagaagaggacagaccgcgtcaagggcaaatgcaccctcatgtga |
Protein Sequence |
>148252 : length: 198 MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQIT DTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVG NKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGK RSGKQKRTDRVKGKCTLM |