|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1672 |
Name | DEFB1 |
Synonym | BD1|DEFB-1|DEFB101|HBD1;defensin, beta 1;DEFB1;defensin, beta 1 |
Definition | BD-1|beta-defensin 1|beta-defensin-1 |
Position | 8p23.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "hBD-1 might function as a tumor suppressor gene in oral squamous cell carcinoma, while hBD-2 and -3 might be protooncogenes." |
| More detail of all 1 literatures about DEFB1 | |
|
External Links |
|
Links to Entrez Gene | 1672 |
Links to all GeneRIF Items | 1672 |
Links to iHOP | 1672 |
|
Sequence Information |
|
Nucleotide Sequence |
>1672 : length: 207 atgagaacttcctaccttctgctgtttactctctgcttacttttgtctgagatggcctca ggtggtaactttctcacaggccttggccacagatctgatcattacaattgcgtcagcagt ggagggcaatgtctctattctgcctgcccgatctttaccaaaattcaaggcacctgttac agagggaaggccaagtgctgcaagtga |
Protein Sequence |
>1672 : length: 68 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY RGKAKCCK |