|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 171023 |
Name | ASXL1 |
Synonym | BOPS|MDS;additional sex combs like 1 (Drosophila);ASXL1;additional sex combs like 1 (Drosophila) |
Definition | additional sex combs-like protein 1|putative Polycomb group protein ASXL1 |
Position | 20q11 |
Gene Type | protein-coding |
Source | Count: 1; Pubmed_search |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | These findings suggest that ASXL1 may function as a tumor suppressor in malignancies of the myeloid lineage by affecting stem or progenitor cell self-renewal or differentiation. |
| More detail of all 1 literatures about ASXL1 | |
|
External Links |
|
Links to Entrez Gene | 171023 |
Links to all GeneRIF Items | 171023 |
Links to iHOP | 171023 |
|
Sequence Information |
|
Nucleotide Sequence |
>171023 : length: 258 atgaaggacaaacagaagaagaagaaggagcgcacgtgggccgaggccgcgcgcctggta ttagaaaactactcggatgctccaatgacaccaaaacagattctgcaggtcatagaggca gaaggactaaaggaaatgagaagtgggacttcccctctcgcatgcctcaatgctatgcta cattccaattcaagaggaggagaggggttgttttataaactgcctggccgaatcagcctt ttcacgctcaaggtgtga |
Protein Sequence |
>171023 : length: 85 MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAML HSNSRGGEGLFYKLPGRISLFTLKV |