|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1801 |
Name | DPH1 |
Synonym | DPH2L|DPH2L1|OVCA1;DPH1 homolog (S. cerevisiae);DPH1;DPH1 homolog (S. cerevisiae) |
Definition | DPH-like 1|DPH2-like 1|candidate tumor suppressor in ovarian cancer 1|diphthamide biosynthesis protein 1|diphthamide biosynthesis protein 2 homolog-like 1|diptheria toxin resistance protein required for diphthamide biosynthesis (Saccharomyces)-like 1|dipt |
Position | 17p13.3 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Identification of two candidate tumor suppressor genes on chromosome 17p13.3. Using allelic loss mapping and positional cloning methods, we have recently identified two novel genes, which we refer to as OVCA1 and OVCA2, that map to 17p13.3." |
reviewed | OVCA1: tumor suppressor gene. |
reviewed | Gene trap mutagenesis-based forward genetic approach reveals that the tumor suppressor OVCA1 is a component of the biosynthetic pathway of diphthamide on elongation factor 2. |
reviewed | OVCA1: emerging as a bona fide tumor suppressor. |
potential | "Identification and structural analysis of human RBM8A and RBM8B: two highly conserved RNA-binding motif proteins that interact with OVCA1, a candidate tumor suppressor." |
potential | "Expression of OVCA1, a candidate tumor suppressor, is reduced in tumors and inhibits growth of ovarian cancer cells." |
reviewed | Ovca1 is a tumor suppressor that can modify p53-induced tumorigenesis and suggest that it acts as a positive regulator for cell cycle progression. |
| More detail of all 7 literatures about DPH1 | |
|
External Links |
|
Links to Entrez Gene | 1801 |
Links to all GeneRIF Items | 1801 |
Links to iHOP | 1801 |
|
Sequence Information |
|
Nucleotide Sequence |
>1801 : length: 1332 atgcgcaggcaggtgatggcggcgctggtcgtatccggggcagcggagcagggcggccga gacggccctggcagaggtcgggcccctcggggccgcgtggccaatcagatcccccctgag atcctgaagaaccctcagctgcaggcagcaatccgggtcctgccttccaactacaacttt gagatccccaagaccatctggaggatccaacaagcccaggccaagaaggtggccttgcaa atgccggaaggcctcctcctctttgcctgtaccattgtggatatcttggaaaggttcacg gaggccgaagtgatggtgatgggtgacgtgacctacggggcttgctgtgtggatgacttc acagcgagggccctgggagctgacttcttggtgcactacggccacagttgcctgattccc atggacacctcggcccaagacttccgggtgctgtacgtctttgtggacatccggatagac actacacacctcctggactctctccgcctcacctttcccccagccactgcccttgccctg gtcagcaccattcagtttgtgtcgaccttgcaggcagccgcccaggagctgaaagccgag tatcgtgtgagtgtcccacagtgcaagcccctgtcccctggagagatcctgggctgcaca tccccccgactgtccaaagaggtggaggccgttgtgtatcttggagatggccgcttccat ctggagtctgtcatgattgccaaccccaatgtccccgcttaccggtatgacccatatagc aaagtcctatccagagaacactatgaccaccagcgcatgcaggctgctcgccaagaagcc atagccactgcccgctcagctaagtcctggggccttattctgggcactttgggccgccag ggcagtcctaagatcctggagcacctggaatctcgactccgagccttgggcctttccttt gtgaggctgctgctctctgagatcttccccagcaagcttagcctacttcctgaggtggat gtgtgggtgcaggtggcatgtccacgtctctccattgactggggcacagccttccccaag ccgctgctgacaccctatgaggcggccgtggctctgagggacatttcctggcagcagccc tacccgatggacttctacgctggcagctccttggggccctggacggtgaaccacggccag gaccgccgtccccacgccccgggccggcccgcgcgggggaaggtgcaggaggggtccgcg cgtcccccttcggccgtggcttgcgaggactgcagctgcagggacgagaaggtggcgccg ctggctccttga |
Protein Sequence |
>1801 : length: 443 MRRQVMAALVVSGAAEQGGRDGPGRGRAPRGRVANQIPPEILKNPQLQAAIRVLPSNYNF EIPKTIWRIQQAQAKKVALQMPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDF TARALGADFLVHYGHSCLIPMDTSAQDFRVLYVFVDIRIDTTHLLDSLRLTFPPATALAL VSTIQFVSTLQAAAQELKAEYRVSVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFH LESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQ GSPKILEHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVDVWVQVACPRLSIDWGTAFPK PLLTPYEAAVALRDISWQQPYPMDFYAGSSLGPWTVNHGQDRRPHAPGRPARGKVQEGSA RPPSAVACEDCSCRDEKVAPLAP |