|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 1942 |
Name | EFNA1 |
Synonym | B61|ECKLG|EFL1|EPLG1|LERK-1|LERK1|TNFAIP4;ephrin-A1;EFNA1;ephrin-A1 |
Definition | TNF alpha-induced protein 4|eph-related receptor tyrosine kinase ligand 1|immediate early response protein B61|ligand of eph-related kinase 1|tumor necrosis factor alpha-induced protein 4|tumor necrosis factor, alpha-induced protein 4 |
Position | 1q21-q22 |
Gene Type | protein-coding |
Source | Count: 1; UniProt |
Literature support | Count: 0 PubMed records as below. |
Evidence Status |
Description |
| . |
More detail of all 0 literatures about EFNA1 | |
Pathways and Diseases |
|
Pathway | EPHA2 forward signaling;PID Curated;200185 |
Pathway | Arf6 signaling events;PID Curated;200060 |
Pathway | Axon guidance;KEGG PATHWAY;hsa04360 |
Pathway | HIF-2-alpha transcription factor network;PID Curated;200030 |
Pathway | Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155 |
Pathway | EPHA forward signaling;PID Curated;200121 |
Disease | Brain tumor;FunDO |
Disease | Pre-Eclampsia;FunDO |
Disease | Asthma;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Bladder cancer;FunDO |
External Links |
|
Links to Entrez Gene | 1942 |
Links to all GeneRIF Items | 1942 |
Links to iHOP | 1942 |
Sequence Information |
|
Nucleotide Sequence |
>1942 : length: 618 atggagttcctctgggcccctctcttgggtctgtgctgcagtctggccgctgctgatcgc cacaccgtcttctggaacagttcaaatcccaagttccggaatgaggactacaccatacat gtgcagctgaatgactacgtggacatcatctgtccgcactatgaagatcactctgtggca gacgctgccatggagcagtacatactgtacctggtggagcatgaggagtaccagctgtgc cagccccagtccaaggaccaagtccgctggcagtgcaaccggcccagtgccaagcatggc ccggagaagctgtctgagaagttccagcgcttcacacctttcaccctgggcaaggagttc aaagaaggacacagctactactacatctccaaacccatccaccagcatgaagaccgctgc ttgaggttgaaggtgactgtcagtggcaaaatcactcacagtcctcaggcccatgacaat ccacaggagaagagacttgcagcagatgacccagaggtgcgggttctacatagcatcggt cacagtgctgccccacgcctcttcccacttgcctggactgtgctgctccttccacttctg ctgctgcaaaccccgtga |
Protein Sequence |
>1942 : length: 205 MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG HSAAPRLFPLAWTVLLLPLLLLQTP |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |