|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 2012 |
Name | EMP1 |
Synonym | CL-20|EMP-1|TMP;epithelial membrane protein 1;EMP1;epithelial membrane protein 1 |
Definition | tumor-associated membrane protein |
Position | 12p12.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | Decreased expression of EMP1 was significantly correlated with clinical stage (p=0.002) and lymph node metastasis (p=0.044) of patients with oral squamous cell carcinoma and may be a tumor suppressor. |
potential | Decreased expression of EMP1 was significantly correlated with clinical stage (p=0.002) and lymph node metastasis (p=0.044) of patients with oral squamous cell carcinoma and may be a tumor suppressor. |
More detail of all 1 literatures about EMP1 | |
External Links |
|
Links to Entrez Gene | 2012 |
Links to all GeneRIF Items | 2012 |
Links to iHOP | 2012 |
Sequence Information |
|
Nucleotide Sequence |
>2012 : length: 474 atgttggtattgctggctggtatctttgtggtccacatcgctactgttattatgctattt gttagcaccattgccaatgtctggttggtttccaatacggtagatgcatcagtaggtctt tggaaaaactgtaccaacattagctgcagtgacagcctgtcatatgccagtgaagatgcc ctcaagacagtgcaggccttcatgattctctctatcatcttctgtgtcattgccctcctg gtcttcgtgttccagctcttcaccatggagaagggaaaccggttcttcctctcaggggcc accacactggtgtgctggctgtgcattcttgtgggggtgtccatctacactagtcattat gcgaatcgtgatggaacgcagtatcaccacggctattcctacatcctgggctggatctgc ttctgcttcagcttcatcatcggcgttctctatctggtcctgagaaagaaataa |
Protein Sequence |
>2012 : length: 157 MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |