|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 2120 |
Name | ETV6 |
Synonym | TEL|TEL/ABL;ets variant 6;ETV6;ets variant 6 |
Definition | ETS translocation variant 6|ETS-related protein Tel1|TEL1 oncogene|ets variant gene 6 (TEL oncogene)|transcription factor ETV6 |
Position | 12p13 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 5 PubMed records as below. |
Evidence Status | Description |
potential | This cell line will be very useful in studying the different mechanisms by which alterations of ETV6 contribute to leukemogenesis and in testing the hypothesis that ETV6 might act as a tumor suppressor gene. |
reviewed | ETV6 generally plays as tumor-suppressor gene in leukemia. |
reviewed | "The deleted segment on 12p contains several genes, among the tumor suppressor genes ETV6 and CDKN1B, which are frequently involved in 12p abnormalities in childhood ALL." |
potential | "Small ubiquitin-like modifier conjugation regulates nuclear export of TEL, a putative tumor suppressor." |
potential | "TEL, a putative tumor suppressor, induces apoptosis and represses transcription of Bcl-XL." |
| More detail of all 5 literatures about ETV6 | |
Pathways and Diseases | |
Pathway | Dorso-ventral axis formation;KEGG PATHWAY;hsa04320 |
Disease | Primary biliary cirrhosis;FunDO |
Disease | Eosinophilia;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Leukemia, acute myeloid, somatic;OMIM |
Disease | Height;NHGRI |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Lymphoma;FunDO |
Disease | DEVELOPMENTAL;GAD |
Disease | Leukemia;FunDO |
Disease | Bone marrow disease;FunDO |
Disease | Cancer;FunDO |
Disease | Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001 |
Disease | height;GAD |
External Links | |
Links to Entrez Gene | 2120 |
Links to all GeneRIF Items | 2120 |
Links to iHOP | 2120 |
Sequence Information | |
Nucleotide Sequence | >2120 : length: 1359 atgtctgagactcctgctcagtgtagcattaagcaggaacgaatttcatatacacctcca gagagcccagtgccgagttacgcttcctcgacgccacttcatgttccagtgcctcgagcg ctcaggatggaggaagactcgatccgcctgcctgcgcacctgcgcttgcagccaatttac tggagcagggatgacgtagcccagtggctcaagtgggctgaaaatgagttttctttaagg ccaattgacagcaacacgtttgaaatgaatggcaaagctctcctgctgctgaccaaagag gactttcgctatcgatctcctcattcaggtgatgtgctctatgaactccttcagcatatt ctgaagcagaggaaacctcggattcttttttcaccattcttccaccctggaaactctata cacacacagccggaggtcatactgcatcagaaccatgaagaagataactgtgtccagagg acccccaggccatccgtggataatgtgcaccataaccctcccaccattgaactgttgcac cgctccaggtcacctatcacgacaaatcaccggccttctcctgaccccgagcagcggccc ctccggtcccccctggacaacatgatccgccgcctctccccggctgagagagctcaggga cccaggccgcaccaggagaacaaccaccaggagtcctaccctctgtcagtgtctcccatg gagaataatcactgcccagcgtcctccgagtcccacccgaagccatccagcccccggcag gagagcacacgcgtgatccagctgatgcccagccccatcatgcaccctctgatcctgaac ccccggcactccgtggatttcaaacagtccaggctctccgaggacgggctgcatagggaa gggaagcccatcaacctctctcatcgggaagacctggcttacatgaaccacatcatggtc tctgtctccccgcctgaagagcacgccatgcccattgggagaatagcagactgtagactg ctttgggattacgtctatcagttgctttctgacagccggtacgaaaacttcatccgatgg gaggacaaagaatccaaaatattccggatagtggatcccaacggactggctcgactgtgg ggaaaccataagaacagaacaaacatgacctatgagaaaatgtccagagccctgcgccac tactacaaactaaacattatcaggaaggagccaggacaaaggcttttgttcaggtttatg aaaaccccagatgaaatcatgagtggccgaacagaccgtctggagcacctagagtcccag gagctggatgaacaaatataccaagaagatgaatgctga |
Protein Sequence | >2120 : length: 452 MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |