|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 2170 |
Name | FABP3 |
Synonym | FABP11|H-FABP|M-FABP|MDGI|O-FABP;fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor);FABP3;fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) |
Definition | Fatty acid-binding protein 3, muscle|fatty acid binding protein 11|fatty acid-binding protein, heart|heart-type fatty acid-binding protein|mammary-derived growth inhibitor|muscle fatty acid-binding protein |
Position | 1p33-p32 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | Dinucleotide repeat in the third intron of the FABP3/MDGI putative tumor suppressor gene. |
reviewed | "tumor suppressor activity of the gene encoding mammary-derived growth inhibitor. The gene encoding mammary-derived growth inhibitor (MDGI), a protein previously purified from bovine mammary gland and shown to have modest antiproliferative activity for human breast cancer cells in vitro, is demonstrated to function as a potent tumor suppressor gene. ". |
| More detail of all 2 literatures about FABP3 | |
|
Pathways and Diseases |
|
Pathway | PPAR signaling pathway;KEGG PATHWAY;hsa03320 |
Disease | Heart failure;FunDO |
Disease | Down syndrome;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Lung cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 2170 |
Links to all GeneRIF Items | 2170 |
Links to iHOP | 2170 |
|
Sequence Information |
|
Nucleotide Sequence |
>2170 : length: 402 atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc acaatcatcgaaaagaatggggacattctcaccctaaaaacacacagcaccttcaagaac acagagatcagctttaagttgggggtggagttcgatgagacaacagcagatgacaggaag gtcaagtccattgtgacactggatggagggaaacttgttcacctgcagaaatgggacggg caagagaccacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac ggcactgcagtttgcactcgcacttatgagaaagaggcatga |
Protein Sequence |
>2170 : length: 133 MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH GTAVCTRTYEKEA |