|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 2272 |
Name | FHIT |
Synonym | AP3Aase|FRA3B;fragile histidine triad gene;FHIT;fragile histidine triad gene |
Definition | AP3A hydrolase|bis(5'-adenosyl)-triphosphatase|diadenosine 5',5'''-P1,P3-triphosphate hydrolase|dinucleosidetriphosphatase|fragile histidine triad protein|tumor suppressor protein |
Position | 3p14.2 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,UniProt,Generif |
Literature support | Count: 26 PubMed records as below. |
Evidence Status | Description |
potential | "MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family." |
potential | Potential gastrointestinal tumor suppressor locus at the 3p14.2 FRA3B site identified by homozygous deletions in tumor cell lines. |
reviewed | tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma (PEL) cell lines. |
reviewed | Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts. |
reviewed | Helicobacter pylori infection and family history of gastric cancer decrease expression of FHIT tumor suppressor gene in gastric mucosa of dyspeptic patients. |
reviewed | Aberration of the enzymatic activity of Fhit tumor suppressor protein enhances cancer cell death upon photodynamic therapy similarly to that driven by wild-type Fhit. |
reviewed | "substrate binding, interaction with heat shock proteins, mitochondrial localization, and interaction with Fdxr are important for Fhit tumor suppressor function". |
reviewed | These observations assign to the tumor suppressor Fhit an unexpected role in the regulation of beta-catenin-mediated gene transcription. |
reviewed | "absence or poor expression of the Fhit protein in anal cancers suggests a role for this tumor suppressor gene product, as a risk factor, in the onset of this cancer, as reported before for other gastrointestinal tumors". |
reviewed | Induction of apoptosis by tumor suppressor FHIT via death receptor signaling pathway in human lung cancer cells. |
| More detail of all 26 literatures about FHIT | |
Pathways and Diseases | |
Pathway | Purine metabolism;KEGG PATHWAY;hsa00230 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Disease | ADHD;GAD |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Gastrointestinal tumor;FunDO |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | tumour kinetics and chromosomal instability;GAD |
Disease | cervical cancer;GAD |
Disease | Infection;FunDO |
Disease | prostate cancer;GAD |
Disease | Major depressive disorder;NHGRI |
Disease | Attention deficit hyperactivity disorder;NHGRI |
Disease | PSYCH;GAD |
Disease | Non-small cell lung cancer;KEGG DISEASE;H00014 |
Disease | Penile disease;FunDO |
Disease | CANCER;GAD |
Disease | attention-deficit hyperactivity disorder;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | major depressive disorder;GAD |
Disease | Small cell lung cancer;KEGG DISEASE;H00013 |
Disease | Testicular dysfunction;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | smoking;GAD |
Disease | transcriptional inactivation of the FHIT gene;GAD |
Disease | lung cancer and preneoplastic bronchial lesions;GAD |
External Links | |
Links to Entrez Gene | 2272 |
Links to all GeneRIF Items | 2272 |
Links to iHOP | 2272 |
Sequence Information | |
Nucleotide Sequence | >2272 : length: 444 atgtcgttcagatttggccaacatctcatcaagccctctgtagtgtttctcaaaacagaa ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtccttgtgtgcccg ctgcggccagtggagcgcttccatgacctgcgtcctgatgaagtggccgatttgtttcag acgacccagagagtcgggacagtggtggaaaaacatttccatgggacctctctcaccttt tccatgcaggatggccccgaagccggacagactgtgaagcacgttcacgtccatgttctt cccaggaaggctggagactttcacaggaatgacagcatctatgaggagctccagaaacat gacaaggaggactttcctgcctcttggagatcagaggaggaaatggcagcagaagccgca gctctgcgggtctactttcagtga |
Protein Sequence | >2272 : length: 147 MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH DKEDFPASWRSEEEMAAEAAALRVYFQ |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |