Entrez Gene

General information | Expression | Regulation | Mutation | Interaction

Basic Information
Gene ID	2272
Name	FHIT
Synonym	AP3Aase\|FRA3B;fragile histidine triad gene;FHIT;fragile histidine triad gene
Definition	AP3A hydrolase\|bis(5'-adenosyl)-triphosphatase\|diadenosine 5',5'''-P1,P3-triphosphate hydrolase\|dinucleosidetriphosphatase\|fragile histidine triad protein\|tumor suppressor protein
Position	3p14.2
Gene Type	protein-coding
Source	Count: 4; Pubmed_search,TAG,UniProt,Generif
Literature support	Count: 26 PubMed records as below.
Evidence Status	Description
potential	"MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family."
potential	Potential gastrointestinal tumor suppressor locus at the 3p14.2 FRA3B site identified by homozygous deletions in tumor cell lines.
reviewed	tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma (PEL) cell lines.
reviewed	Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts.
reviewed	Helicobacter pylori infection and family history of gastric cancer decrease expression of FHIT tumor suppressor gene in gastric mucosa of dyspeptic patients.
reviewed	Aberration of the enzymatic activity of Fhit tumor suppressor protein enhances cancer cell death upon photodynamic therapy similarly to that driven by wild-type Fhit.
reviewed	"substrate binding, interaction with heat shock proteins, mitochondrial localization, and interaction with Fdxr are important for Fhit tumor suppressor function".
reviewed	These observations assign to the tumor suppressor Fhit an unexpected role in the regulation of beta-catenin-mediated gene transcription.
reviewed	"absence or poor expression of the Fhit protein in anal cancers suggests a role for this tumor suppressor gene product, as a risk factor, in the onset of this cancer, as reported before for other gastrointestinal tumors".
reviewed	Induction of apoptosis by tumor suppressor FHIT via death receptor signaling pathway in human lung cancer cells.
	More detail of all 26 literatures about FHIT
Pathways and Diseases
Pathway	Purine metabolism;KEGG PATHWAY;hsa00230
Pathway	Non-small cell lung cancer;KEGG PATHWAY;hsa05223
Pathway	Small cell lung cancer;KEGG PATHWAY;hsa05222
Disease	ADHD;GAD
Disease	Epstein-Barr virus infection;FunDO
Disease	Cancers of the lung and pleura;KEGG DISEASE
Disease	Gastrointestinal tumor;FunDO
Disease	Cancer;FunDO
Disease	Oral cancer;FunDO
Disease	tumour kinetics and chromosomal instability;GAD
Disease	cervical cancer;GAD
Disease	Infection;FunDO
Disease	prostate cancer;GAD
Disease	Major depressive disorder;NHGRI
Disease	Attention deficit hyperactivity disorder;NHGRI
Disease	PSYCH;GAD
Disease	Non-small cell lung cancer;KEGG DISEASE;H00014
Disease	Penile disease;FunDO
Disease	CANCER;GAD
Disease	attention-deficit hyperactivity disorder;GAD
Disease	Cancers;KEGG DISEASE
Disease	major depressive disorder;GAD
Disease	Small cell lung cancer;KEGG DISEASE;H00013
Disease	Testicular dysfunction;FunDO
Disease	Congenital abnormality;FunDO
Disease	smoking;GAD
Disease	transcriptional inactivation of the FHIT gene;GAD
Disease	lung cancer and preneoplastic bronchial lesions;GAD
External Links
Links to Entrez Gene	2272
Links to all GeneRIF Items	2272
Links to iHOP	2272
Sequence Information
Nucleotide Sequence	>2272 : length: 444 atgtcgttcagatttggccaacatctcatcaagccctctgtagtgtttctcaaaacagaa ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtccttgtgtgcccg ctgcggccagtggagcgcttccatgacctgcgtcctgatgaagtggccgatttgtttcag acgacccagagagtcgggacagtggtggaaaaacatttccatgggacctctctcaccttt tccatgcaggatggccccgaagccggacagactgtgaagcacgttcacgtccatgttctt cccaggaaggctggagactttcacaggaatgacagcatctatgaggagctccagaaacat gacaaggaggactttcctgcctcttggagatcagaggaggaaatggcagcagaagccgca gctctgcgggtctactttcagtga
Protein Sequence	>2272 : length: 147 MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH DKEDFPASWRSEEEMAAEAAALRVYFQ