|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 231 |
Name | AKR1B1 |
Synonym | ADR|ALDR1|ALR2|AR;aldo-keto reductase family 1, member B1 (aldose reductase);AKR1B1;aldo-keto reductase family 1, member B1 (aldose reductase) |
Definition | Lii5-2 CTCL tumor antigen|aldehyde reductase 1|aldo-keto reductase family 1 member B1|aldose reductase|low Km aldose reductase |
Position | 7q35 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status | Description |
potential | Aldose reductase gene was identified in the genome-wide loss-of-function genetic screen as putative tumor suppressor located at 7q35. |
| More detail of all 1 literatures about AKR1B1 | |
Pathways and Diseases | |
Pathway | Fructose and mannose metabolism;KEGG PATHWAY;hsa00051 |
Pathway | Galactose metabolism;KEGG PATHWAY;hsa00052 |
Pathway | Hormone biosynthesis;Reactome;REACT:15314 |
Pathway | Pentose and glucuronate interconversions;KEGG PATHWAY;hsa00040 |
Pathway | methylglyoxal degradation III;BioCyc;PWY-5453 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Glycerolipid metabolism;KEGG PATHWAY;hsa00561 |
Pathway | Pyruvate metabolism;KEGG PATHWAY;hsa00620 |
Pathway | Metabolism of lipids and lipoproteins;Reactome;REACT:22258 |
Pathway | Pregnenolone biosynthesis;PID Reactome;500773 |
Pathway | acetone degradation I (to methylglyoxal);BioCyc;PWY-5451 |
Disease | Ischemia;FunDO |
Disease | Common cold;FunDO |
Disease | retinopathy, diabetic;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | RENAL;GAD |
Disease | VISION;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | Adrenal gland tumor;FunDO |
Disease | METABOLIC;GAD |
Disease | Pancreas disease;FunDO |
Disease | Metabolism disease;FunDO |
Disease | diabetes, type 2;GAD |
Disease | Colon cancer;FunDO |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 231 |
Links to all GeneRIF Items | 231 |
Links to iHOP | 231 |
Sequence Information | |
Nucleotide Sequence | >231 : length: 951 atggcaagccgtctcctgctcaacaacggcgccaagatgcccatcctggggttgggtacc tggaagtcccctccagggcaggtgactgaggccgtgaaggtggccattgacgtcgggtac cgccacatcgactgtgcccatgtgtaccagaatgagaatgaggtgggggtggccattcag gagaagctcagggagcaggtggtgaagcgtgaggagctcttcatcgtcagcaagctgtgg tgcacgtaccatgagaagggcctggtgaaaggagcctgccagaagacactcagcgacctg aagctggactacctggacctctaccttattcactggccgactggctttaagcctgggaag gaatttttcccattggatgagtcgggcaatgtggttcccagtgacaccaacattctggac acgtgggcggccatggaagagctggtggatgaagggctggtgaaagctattggcatctcc aacttcaaccatctccaggtggagatgatcttaaacaaacctggcttgaagtataagcct gcagttaaccagattgagtgccacccatatctcactcaggagaagttaatccagtactgc cagtccaaaggcatcgtggtgaccgcctacagccccctcggctctcctgacaggccctgg gccaagcccgaggacccttctctcctggaggatcccaggatcaaggcgatcgcagccaag cacaataaaactacagcccaggtcctgatccggttccccatgcagaggaacttggtggtg atccccaagtctgtgacaccagaacgcattgctgagaactttaaggtctttgactttgaa ctgagcagccaggatatgaccaccttactcagctacaacaggaactggagggtctgtgcc ttgttgagctgtacctcccacaaggattaccccttccatgaagagttttga |
Protein Sequence | >231 : length: 316 MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA LLSCTSHKDYPFHEEF |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |