|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 23261 |
Name | CAMTA1 |
Synonym | -;calmodulin binding transcription activator 1;CAMTA1;calmodulin binding transcription activator 1 |
Definition | calmodulin-binding transcription activator 1 |
Position | 1p36.31-p36.23 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | Findings define properties of CAMTA1 in growth suppression and neuronal differentiation that support its assignment as a 1p36 tumor suppressor gene in neuroblastoma. |
potential | "Allelic losses at 1p36 and 19q13 in gliomas: correlation with histologic classification, definition of a 150-kb minimal deleted region on 1p36, and evaluation of CAMTA1 as a candidate tumor suppressor gene." |
potential | FLJ10737 and CAMTA1 genes on 1p36.31-p36.23 are candidate tumor suppressor genes of neuroblastoma. |
| More detail of all 3 literatures about CAMTA1 | |
|
External Links |
|
Links to Entrez Gene | 23261 |
Links to all GeneRIF Items | 23261 |
Links to iHOP | 23261 |
|
Sequence Information |
|
Nucleotide Sequence |
>23261 : length: 243 atgtggcgcgcggaggggaaatggctgccgaaaacaagccggaagagcgtttcccaaagt gtattctgcggaactagcacctactgtgttctcaacaccgtgccacctatagaagatgat catgggaacagcaatagtagtcatgtaaaaatctttttaccgaaaaagctgcttgaatgt ctgccgaaatgttcaagtttaccaaaagagaggcaccgctggaacactaatgagagatca tga |
Protein Sequence |
>23261 : length: 80 MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLEC LPKCSSLPKERHRWNTNERS |