|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 23541 |
Name | SEC14L2 |
Synonym | C22orf6|SPF|TAP|TAP1;SEC14-like 2 (S. cerevisiae);SEC14L2;SEC14-like 2 (S. cerevisiae) |
Definition | SEC14-like protein 2|alpha-tocopherol-associated protein|squalene transfer protein|supernatant protein factor|tocopherol-associated protein |
Position | 22q12.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status |
Description |
potential | Fndings raise the possibility that TAP/Sec14L2 may serve as a tumor suppressor in breast carcinogenesis. |
potential | "TAP not only mediates vitamin E absorption to facilitate vitamin E antiproliferation effect in prostate cancer cells, but also functions like a tumor suppressor gene to control cancer cell viability through a non-vitamin E manner." |
More detail of all 2 literatures about SEC14L2 | |
External Links |
|
Links to Entrez Gene | 23541 |
Links to all GeneRIF Items | 23541 |
Links to iHOP | 23541 |
Sequence Information |
|
Nucleotide Sequence |
>23541 : length: 963 atgagcggcagagtcggcgatctgagccccaggcagaaggaggcattggccaagtttcgg gagaatgtccaggatgtgctgccggccctgccgaatccagatgactattttctcctgcgt tggctccgagccagaagcttcgacctgcagaagtcggaggccatgctccggaagttgggg aggaaggtggagaccatcaccataatttatgactgcgaggggcttggcctcaagcatctc tggaagcctgctgtggaggcctatggagagtttctctgcatgtttgaggaaaattatccc gaaacactgaagcgtctttttgttgttaaagcccccaaactgtttcctgtggcctataac ctcatcaaacccttcctgagtgaggacactcgtaagaagatcatggtcctgggagcaaat tggaaggaggttttactgaaacatatcagccctgaccaggtgcctgtggagtatgggggc accatgactgaccctgatggaaaccccaagtgcaaatccaagatcaactacgggggtgac atccccaggaagtattatgtgcgagaccaggtgaaacagcagtatgaacacagcgtgcag atttcccgtggctcctcccaccaagtggagtatgagatcctcttccctggctgtgtcctc aggtggcagtttatgtcagatggagcggatgttggttttgggattttcctgaagaccaag atgggagagaggcagcgggcaggggagatgacagaggtgctgcccaaccagaggtacaac tcccacctggtccctgaagatgggaccctcacctgcagtgatcctggcatctatgtcctg cggtttgacaacacctacagcttcattcatgccaagaaggtcaatttcactgtggaggtc ctgcttccagacaaagcctcagaagagaagatgaaacagctgggggcaggcaccccgaaa taa |
Protein Sequence |
>23541 : length: 320 MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKLG RKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYN LIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGD IPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTK MGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEV LLPDKASEEKMKQLGAGTPK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |