|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 23705 |
Name | CADM1 |
Synonym | BL2|IGSF4|IGSF4A|NECL2|Necl-2|RA175|ST17|SYNCAM|TSLC1|sTSLC-1|sgIGSF|synCAM1;cell adhesion molecule 1;CADM1;cell adhesion molecule 1 |
Definition | TSLC-1|TSLC1/Nectin-like 2/IGSF4|immunoglobulin superfamily member 4|immunoglobulin superfamily, member 4|immunoglobulin superfamily, member 4D variant 2|nectin-like 2|nectin-like protein 2|spermatogenic immunoglobulin superfamily|synaptic cell adhesion m |
Position | 11q23.2 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 27 PubMed records as below. |
Evidence Status | Description |
reviewed | tumor suppressor cell adhesion molecule 1 (CADM1) is cleaved by a disintegrin and metalloprotease 10 (ADAM10) and subsequently cleaved by γ-secretase complex. |
reviewed | the effect of 4.1B deficiency on tumor suppressor in lung cancer-1 distribution were also investigated using rodent pheochromocytoma and 4.1B-knockout mice. |
reviewed | tumor suppressor in lung cancer-1 as a novel ameloblast adhesion molecule and its downregulation in ameloblastoma. |
reviewed | tumor suppressor in lung cancer-1 (TSLC1) functions as a glioma tumor suppressor. |
reviewed | The tumor suppressor TSLC1/NECL-2 triggers NK-cell and CD8+ T-cell responses through the cell-surface receptor CRTAM. |
reviewed | "RA175, which is the mouse ortholog of TSLC1, a tumor suppressor gene in human lung cancer, is a cell adhesion molecule." |
reviewed | "Identification of the Tslc1 gene, a mouse orthologue of the human tumor suppressor TSLC1 gene." |
reviewed | Involvement of tumor suppressor in lung cancer 1 gene expression in cervical carcinogenesis. |
reviewed | Loss/Down-regulation of tumor suppressor in lung cancer 1 expression is associated with ovarian tumor progression. |
reviewed | Structural basis of tumor suppressor in lung cancer 1 (TSLC1) binding to differentially expressed in adenocarcinoma of the lung (DAL-1/4.1B). |
| More detail of all 27 literatures about CADM1 | |
Pathways and Diseases | |
Pathway | Nectin/Necl trans heterodimerization;PID Reactome;500121 |
Pathway | Cell junction organization;Reactome;REACT:20676 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | rac1 cell motility signaling pathway;PID BioCarta;100056 |
Disease | Nasopharyngeal cancer;KEGG DISEASE;H00054 |
Disease | Cancers;KEGG DISEASE |
Disease | Cardiovascular disease risk factors;NHGRI |
Disease | Head and neck cancers;KEGG DISEASE |
External Links | |
Links to Entrez Gene | 23705 |
Links to all GeneRIF Items | 23705 |
Links to iHOP | 23705 |
Sequence Information | |
Nucleotide Sequence | >23705 : length: 1245 atggcgagtgtagtgctgccgagcggatcccagtgtgcggcggcagcggcggcggcggcg cctcccgggctccggctccggcttctgctgttgctcttctccgccgcggcactgatcccc acaggtgatgggcagaatctgtttacgaaagacgtgacagtgatcgagggagaggttgcg accatcagttgccaagtcaataagagtgacgactctgtgattcagctactgaatcccaac aggcagaccatttatttcagggacttcaggcctttgaaggacagcaggtttcagttgctg aatttttctagcagtgaactcaaagtatcattgacaaacgtctcaatttctgatgaagga agatacttttgccagctctataccgatcccccacaggaaagttacaccaccatcacagtc ctggtcccaccacgtaatctgatgatcgatatccagaaagacactgcggtggaaggtgag gagattgaagtcaactgcactgctatggccagcaagccagccacgactatcaggtggttc aaagggaacacagagctaaaaggcaaatcggaggtggaagagtggtcagacatgtacact gtgaccagtcagctgatgctgaaggtgcacaaggaggacgatggggtcccagtgatctgc caggtggagcaccctgcggtcactggaaacctgcagacccagcggtatctagaagtacag tataagcctcaagtgcacattcagatgacttatcctctacaaggcttaacccgggaaggg gacgcgcttgagttaacatgtgaagccatcgggaagccccagcctgtgatggtaacttgg gtgagagtcgatgatgaaatgcctcaacacgccgtactgtctgggcccaacctgttcatc aataacctaaacaaaacagataatggtacataccgctgtgaagcttcaaacatagtgggg aaagctcactcggattatatgctgtatgtatacgattcccgagcaggtgaagaaggctcg atcagggcagtggatcatgccgtgatcggtggcgtcgtggcggtggtggtgttcgccatg ctgtgcttgctcatcattctggggcgctattttgccagacataaaggtacatacttcact catgaagccaaaggagccgatgacgcagcagacgcagacacagctataatcaatgcagaa ggaggacagaacaactccgaagaaaagaaagagtacttcatctag |
Protein Sequence | >23705 : length: 414 MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVA TISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEG RYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWF KGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQ YKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGSIRAVDHAVIGGVVAVVVFAM LCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |