|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 27086 |
Name | FOXP1 |
Synonym | 12CC4|QRF1|hFKH1B;forkhead box P1;FOXP1;forkhead box P1 |
Definition | fork head-related protein like B|forkhead box protein P1|glutamine-rich factor 1 |
Position | 3p14.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status | Description |
potential | The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p. |
| More detail of all 1 literatures about FOXP1 | |
External Links | |
Links to Entrez Gene | 27086 |
Links to all GeneRIF Items | 27086 |
Links to iHOP | 27086 |
Sequence Information | |
Nucleotide Sequence | >27086 : length: 345 atgatgcaagaatctgggactgagacaaaaagtaacggttcagccatccagaatgggtcg ggcggcagcaaccacttactagagtgcggcggtcttcgggaggggcggtccaacggagag acgccggccgtggacatcggggcagctgacctcgcccacgcccagcagcagcagcaacag tggcatctcataaaccatcagccctctaggagtcccagcagttggcttaagagactaatt tcaagcccttgggagttggaagtcctgcaggtccccttgtggggagcagttgctgagacg aagatgagtggacctgtgtgtcagcctaacccttccccattttga |
Protein Sequence | >27086 : length: 114 MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQ WHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |