|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 27122 |
Name | DKK3 |
Synonym | REIC|RIG;dickkopf 3 homolog (Xenopus laevis);DKK3;dickkopf 3 homolog (Xenopus laevis) |
Definition | RIG-like 5-6|RIG-like 7-1|dickkopf homolog 3|dickkopf-3|dickkopf-related protein 3|dkk-3|hDkk-3|regulated in glioma |
Position | 11p15.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "tumor suppressor REIC/Dkk-3 interacts with the dynein light chain, Tctex-1." |
reviewed | data demonstrate that MYCN-regulated miRNAs are able to modulate the expression of the tumor suppressor DKK3 in neuroblastoma. |
potential | Aberrant methylation of the DKK3 promoter downregulates mRNA & protein expression in human breast cancer development. It may be a tumor suppressor in normal breast tissue. |
| More detail of all 3 literatures about DKK3 | |
|
External Links |
|
Links to Entrez Gene | 27122 |
Links to all GeneRIF Items | 27122 |
Links to iHOP | 27122 |
|
Sequence Information |
|
Nucleotide Sequence |
>27122 : length: 1053 atgcagcggcttggggccaccctgctgtgcctgctgctggcggcggcggtccccacggcc cccgcgcccgctccgacggcgacctcggctccagtcaagcccggcccggctctcagctac ccgcaggaggaggccaccctcaatgagatgttccgcgaggttgaggaactgatggaggac acgcagcacaaattgcgcagcgcggtggaagagatggaggcagaagaagctgctgctaaa gcatcatcagaagtgaacctggcaaacttacctcccagctatcacaatgagaccaacaca gacacgaaggttggaaataataccatccatgtgcaccgagaaattcacaagataaccaac aaccagactggacaaatggtcttttcagagacagttatcacatctgtgggagacgaagaa ggcagaaggagccacgagtgcatcatcgacgaggactgtgggcccagcatgtactgccag tttgccagcttccagtacacctgccagccatgccggggccagaggatgctctgcacccgg gacagtgagtgctgtggagaccagctgtgtgtctggggtcactgcaccaaaatggccacc aggggcagcaatgggaccatctgtgacaaccagagggactgccagccggggctgtgctgt gccttccagagaggcctgctgttccctgtgtgcacacccctgcccgtggagggcgagctt tgccatgaccccgccagccggcttctggacctcatcacctgggagctagagcctgatgga gccttggaccgatgcccttgtgccagtggcctcctctgccagccccacagccacagcctg gtgtatgtgtgcaagccgaccttcgtggggagccgtgaccaagatggggagatcctgctg cccagagaggtccccgatgagtatgaagttggcagcttcatggaggaggtgcgccaggag ctggaggacctggagaggagcctgactgaagagatggcgctgagggagcctgcggctgcc gccgctgcactgctgggaggggaagagatttag |
Protein Sequence |
>27122 : length: 350 MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTR DSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL CHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI |