|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 27173 |
Name | SLC39A1 |
Synonym | ZIP1|ZIRTL;solute carrier family 39 (zinc transporter), member 1;SLC39A1;solute carrier family 39 (zinc transporter), member 1 |
Definition | ZIP-1|hZIP1|solute carrier family 39 (zinc transporter), member 3|solute carrier family 39 member 1|zinc transporter ZIP1|zrt- and Irt-like protein 1 |
Position | 1q21 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | results show that hZIP1 overexpression has a functional effect on the malignant potential of prostate cancer cells via inhibition of NF-kappaB-dependent pathways and support the concept that hZIP1 may function as a tumor suppressor gene. |
| More detail of all 1 literatures about SLC39A1 | |
|
Pathways and Diseases |
|
Pathway | Transmembrane transport of small molecules;Reactome;REACT:15518 |
Disease | Cancer;FunDO |
Disease | Prostate cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 27173 |
Links to all GeneRIF Items | 27173 |
Links to iHOP | 27173 |
|
Sequence Information |
|
Nucleotide Sequence |
>27173 : length: 975 atggggccctggggagagccagagctcctggtgtggcgccccgaggcggtagcttcagag cctccagtgcctgtggggctggaggtgaagttgggggccctggtgctgctgctggtgctc accctcctctgcagcctggtgcccatctgtgtgctgcgccggccaggagctaaccatgaa ggctcagcttcccgccagaaagccctgagcctagtaagctgtttcgcggggggcgtcttt ttggccacttgtctcctggacctgctgcctgactacctggctgccatagatgaggccctg gcagccttgcacgtgacgctccagttcccactgcaagagttcatcctggccatgggcttc ttcctggtcctggtgatggagcagatcacactggcttacaaggagcagtcagggccgtca cctctggaggaaacaagggctctgctgggaacagtgaatggtgggccgcagcattggcat gatgggccaggggtcccacaggcgagtggagccccagcaaccccctcagccttgcgtgcc tgtgtactggtgttctccctggccctccactccgtgttcgaggggctggcggtagggctg cagcgagaccgggctcgggccatggagctgtgcctggctttgctgctccacaagggcatc ctggctgtcagcctgtccctgcggctgttgcagagccaccttagggcacaggtggtggct ggctgtgggatcctcttctcatgcatgacacctctaggcatcgggctgggtgcagctctg gcagagtcggcaggacctctgcaccagctggcccagtctgtgctagagggcatggcagct ggcacctttctctatatcacctttctggaaatcctgccccaggagctggccagttctgag caaaggatcctcaaggtcattctgctcctagcaggctttgccctgctcactggcctgctc ttcatccaaatctag |
Protein Sequence |
>27173 : length: 324 MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHE GSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGF FLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVA GCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSE QRILKVILLLAGFALLTGLLFIQI |