|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 27250 |
Name | PDCD4 |
Synonym | H731;programmed cell death 4 (neoplastic transformation inhibitor);PDCD4;programmed cell death 4 (neoplastic transformation inhibitor) |
Definition | neoplastic transformation inhibitor protein|nuclear antigen H731|programmed cell death protein 4|protein 197/15a |
Position | 10q24 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 20 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | tumor suppressor Pdcd4 is a major transcript that is upregulated during in vivo pancreatic islet neogenesis and is expressed in both beta-cell and ductal cell lines. |
reviewed | The tumor suppressors PTEN and PDCD4 are downregulated by RAS in an AP-1- and miR-21-dependent fashion.(mir-21). |
reviewed | Expression patterns of the tumor suppressor PDCD4 and correlation with β-catenin expression in gastric cancers. |
reviewed | Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor. |
reviewed | "Data provide evidence that the tumor suppressor, programmed cell death factor 4 (PDCD4), is a previously unidentified phosphorylation target of CXCL12 signaling in all Chronic Lymphocytic Leukemia cells probed." |
reviewed | Regulation of tumor suppressor PDCD4 by novel protein kinase C isoforms. |
reviewed | Negative regulation of TLR4 via targeting of the proinflammatory tumor suppressor PDCD4 by the microRNA miR-21. |
reviewed | "miR-21 in HeLa cervical cancer cells caused profound suppression of cell proliferation, and up-regulated the expression of the tumor suppressor gene PDCD4." |
reviewed | Identified up-regulation of microRNA-21 (hsa-miR-21) concurrent with down-regulation of potent tumor suppressor proteins PTEN and programmed cell death 4 in cholesteatoma as compared with normal skin. |
reviewed | "Hyaluronan-CD44 interaction with protein kinase C(epsilon) promotes oncogenic signaling by the stem cell marker Nanog and the Production of microRNA-21, leading to down-regulation of the tumor suppressor protein PDCD4, anti-apoptosis, and chemotherapy resistance in breast tumor cells." |
| More detail of all 20 literatures about PDCD4 | |
|
Pathways and Diseases |
|
Pathway | mTOR signaling pathway;PID Curated;200080 |
Disease | Carcinoma;FunDO |
Disease | Breast cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 27250 |
Links to all GeneRIF Items | 27250 |
Links to iHOP | 27250 |
|
Sequence Information |
|
Nucleotide Sequence |
>27250 : length: 1368 atggatgtagaaaatgagcagatactgaatgtaaaccctgcagaaaatgctgggactgag gaaataaagaatgaaataaatggaaattggatttcagcatcctccattaacgaagctaga attaatgccaaggcaaaaaggcgactaaggaaaaactcatcccgggactctggcagaggc gattcggtcagcgacagtgggagtgacgcccttagaagtggattaactgtgccaaccagt ccaaagggaaggttgctggataggcgatccagatctgggaaaggaaggggactaccaaag aaaggtggtgcaggaggcaaaggtgtctggggtacacctggacaggtgtatgatgtggag gaggtggatgtgaaagatcctaactatgatgatgaccaggagaactgtgtttatgaaact gtagttttgcctttggatgaaagggcatttgagaagactttaacaccaatcatacaggaa tattttgagcatggagatactaatgaagttgcggaaatgttaagagatttaaatcttggt gaaatgaaaagtggagtaccagtgttggcagtatccttagcattggaggggaaggctagt catagagagatgacatctaagcttctttctgacctttgtgggacagtaatgagcacaact gatgtggaaaaatcatttgataaattgttgaaagatctacctgaattagcactggatact cctagagcaccacagttggtgggccagtttattgctagagctgttggagatggaatttta tgtaatacctatattgatagttacaaaggaactgtagattgtgtgcaggctagagctgct ctggataaggctaccgtgcttctgagtatgtctaaaggtggaaagcgtaaagatagtgtg tggggctctggaggtgggcagcaatctgtcaatcaccttgttaaagagattgatatgctg ctgaaagaatatttactctctggagacatatctgaagctgaacattgccttaaggaactg gaagtacctcattttcaccatgagcttgtatatgaagctattataatggttttagagtca actggagaaagtacatttaagatgattttggatttattaaagtccctttggaagtcttct accattactgtagaccaaatgaaaagaggttatgagagaatttacaatgaaattccggac attaatctggatgtcccacattcatactctgtgctggagcggtttgtagaagaatgtttt caggctggaataatttccaaacaactcagagatctttgtccttcaaggggcagaaagcgt tttgtaagcgaaggagatggaggtcgtcttaaaccagagagctactga |
Protein Sequence |
>27250 : length: 455 MDVENEQILNVNPAENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRG DSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVE EVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLG EMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDT PRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSV WGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLES TGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECF QAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY |