|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 2878 |
Name | GPX3 |
Synonym | GPx-P|GSHPx-3|GSHPx-P;glutathione peroxidase 3 (plasma);GPX3;glutathione peroxidase 3 (plasma) |
Definition | GPx-3|extracellular glutathione peroxidase|glutathione peroxidase 3|plasma glutathione peroxidase |
Position | 5q23 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | The tumor suppressor activity of GPx3 seems to relate to its ability to suppress the expression of c-met. |
reviewed | GPx3 is a novel tumor suppressor gene. |
More detail of all 1 literatures about GPX3 | |
Pathways and Diseases |
|
Pathway | glutathione redox reactions I;BioCyc;PWY-4081 |
Pathway | Glutathione metabolism;KEGG PATHWAY;hsa00480 |
Pathway | Arachidonic acid metabolism;KEGG PATHWAY;hsa00590 |
Disease | CARDIOVASCULAR;GAD |
Disease | stroke, ischemic;GAD |
External Links |
|
Links to Entrez Gene | 2878 |
Links to all GeneRIF Items | 2878 |
Links to iHOP | 2878 |
Sequence Information |
|
Nucleotide Sequence |
>2878 : length: 681 atggcccggctgctgcaggcgtcctgcctgctttccctgctcctggccggcttcgtctcg cagagccggggacaagagaagtcgaagatggactgccatggtggcataagtggcaccatt tacgagtacggagccctcaccattgatggggaggagtacatccccttcaagcagtatgct ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccagtacatt gaactgaatgcactacaggaagagcttgcaccattcggtctggtcattctgggctttccc tgcaaccaatttggaaaacaggaaccaggagagaactcagagatccttcctaccctcaag tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtc aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggttcacgacatccgc tggaactttgagaagttcctggtggggccagatggtatacccatcatgcgctggcaccac cggaccacggtcagcaacgtcaagatggacatcctgtcctacatgaggcggcaggcagcc ctgggggtcaagaggaagtaa |
Protein Sequence |
>2878 : length: 226 MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |