|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 2944 |
Name | GSTM1 |
Synonym | GST1|GSTM1-1|GSTM1a-1a|GSTM1b-1b|GTH4|GTM1|H-B|MU|MU-1;glutathione S-transferase mu 1;GSTM1;glutathione S-transferase mu 1 |
Definition | GST HB subunit 4|GST class-mu 1|HB subunit 4|S-(hydroxyalkyl)glutathione lyase|glutathione S-alkyltransferase|glutathione S-aralkyltransferase|glutathione S-aryltransferase|glutathione S-transferase M1|glutathione S-transferase Mu 1 |
Position | 1p13.3 |
Gene Type | protein-coding |
Source | Count: 1; TAG |
Literature support | Count: 0 PubMed records as below. |
Evidence Status | Description |
| . | |
| More detail of all 0 literatures about GSTM1 | |
Pathways and Diseases | |
Pathway | Metabolism of xenobiotics by cytochrome P450;KEGG PATHWAY;hsa00980 |
Pathway | Biological oxidations;Reactome;REACT:13433 |
Pathway | Glutathione metabolism;KEGG PATHWAY;hsa00480 |
Pathway | Drug metabolism - cytochrome P450;KEGG PATHWAY;hsa00982 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Pathway | glutathione-mediated detoxification;BioCyc;PWY-4061 |
Disease | Premature birth;FunDO |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | GSTM1 methylation infertility, male;GAD |
Disease | longevity;GAD |
Disease | IMMUNE;GAD |
Disease | endometriosis;GAD |
Disease | Vitiligo;FunDO |
Disease | coke-oven toxicity;GAD |
Disease | benzene toxicity;GAD |
Disease | oral clefting;GAD |
Disease | PSYCH;GAD |
Disease | liver injury, drug-induced;GAD |
Disease | aflatoxin-related hepatocarcinogenesis;GAD |
Disease | cytogenetic studies;GAD |
Disease | Infertility;FunDO |
Disease | Intractable epilepsy;FunDO |
Disease | Peptic esophagitis;FunDO |
Disease | thimerosal sensitization;GAD |
Disease | leukemia, myeloid;GAD |
Disease | lymphoma;GAD |
Disease | Stomach Neoplasms;GAD |
Disease | oral cancer;GAD |
Disease | Dermatitis;FunDO |
Disease | Pancreatitis;FunDO |
Disease | PAH metabolites, urinary;GAD |
Disease | prostate cancer;GAD |
Disease | Drug abuse;FunDO |
Disease | Haematological Neoplasias;GAD |
Disease | high inducibility of cytochrome P450 1A1 gene transcription;GAD |
Disease | Behcet syndrome;FunDO |
Disease | liver cancer;GAD |
Disease | Drug-Induced dyskinesia;FunDO |
Disease | schizophrenia;GAD |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | solar keratosis;GAD |
Disease | Autism;GAD |
Disease | Atherosclerosis;FunDO |
Disease | arsenic metabolism;GAD |
Disease | Parkinson's disease;GAD |
Disease | colorectal cancer stomach cancer;GAD |
Disease | Asthma;FunDO |
Disease | AGING;GAD |
Disease | cirrhosis;GAD |
Disease | Kuhnt-Junius degeneration;FunDO |
Disease | asbestos-associated pulmonary disorders;GAD |
Disease | Polycystic ovary syndrome;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | METABOLIC;GAD |
Disease | Schizophrenia;FunDO |
Disease | Autistic disorder;FunDO |
Disease | colorectal cancer;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | tuberculosis;GAD |
Disease | hepatocellular carcinoma;GAD |
Disease | Testicular dysfunction;FunDO |
Disease | Fetal Growth Retardation;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | metastatic colorectal cancer;GAD |
Disease | REPRODUCTION;GAD |
Disease | breast cancer;GAD |
Disease | urinary PAH metabolites;GAD |
Disease | oxidative stress;GAD |
Disease | Hepatitis;FunDO |
Disease | Upper aerodigestive tract cancers;GAD |
Disease | Periodontitis;FunDO |
Disease | bladder cancer;GAD |
Disease | Tuberculosis;FunDO |
Disease | Parkinson disease;FunDO |
Disease | Actinic keratosis;FunDO |
Disease | nasopharyngeal cancer;GAD |
Disease | hepatitis B;GAD |
Disease | Chronic simple glaucoma;FunDO |
Disease | lung cancer;GAD |
Disease | VISION;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | Infertility, Male;FunDO |
Disease | Stroke;FunDO |
Disease | Varicosity;FunDO |
Disease | Vascular disease;FunDO |
Disease | azathioprine adverse effects;GAD |
Disease | esophageal cancer;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | Multiple sclerosis;FunDO |
Disease | CANCER;GAD |
Disease | Cerebrovascular disorder;FunDO |
Disease | Deafness;FunDO |
Disease | Kidney failure;FunDO |
Disease | chronic toxic encephalopathy;GAD |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | glaucoma, primary open-angle;GAD |
Disease | leukemia;GAD |
Disease | methotrexate toxicity;GAD |
Disease | Barrett's esophagus;FunDO |
External Links | |
Links to Entrez Gene | 2944 |
Links to all GeneRIF Items | 2944 |
Links to iHOP | 2944 |
Sequence Information | |
Nucleotide Sequence | >2944 : length: 657 atgcccatgatactggggtactgggacatccgcgggctggcccacgccatccgcctgctc ctggaatacacagactcaagctatgaggaaaagaagtacacgatgggggacgctcctgat tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg ccctacttgattgatggggctcacaagatcacccagagcaacgccatcttgtgctacatt gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg gagaaccagaccatggacaaccatatgcagctgggcatgatctgctacaatccagaattt gagaaactgaagccaaagtacttggaggaactccctgaaaagctaaagctctactcagag tttctggggaagcggccatggtttgcaggaaacaagatcacttttgtagattttctcgtc tatgatgtccttgacctccaccgtatatttgagcccaagtgcttggacgccttcccaaat ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc agccgcttcctcccaagacctgtgttctcaaagatggctgtctggggcaacaagtag |
Protein Sequence | >2944 : length: 218 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |