|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 2952 |
Name | GSTT1 |
Synonym | -;glutathione S-transferase theta 1;GSTT1;glutathione S-transferase theta 1 |
Definition | GST class-theta-1|glutathione S-transferase theta-1|glutathione transferase T1-1 |
Position | 22q11.23 |
Gene Type | protein-coding |
Source | Count: 2; TAG,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | "GSTT1 is a potential tumor suppressor gene, and its deletion and null genotype are suggested to be related to development of CML and to clinical outcome in CML ". |
potential | Increased frequencies of glutathione-S-transferase (GSTM1 and GSTT1) null genotypes in Indian patients with chronic myeloid leukemia. |
potential | two TSGs were found located inside the deleted sequences of chromosome 22: SMARCB1 and GSTT1. |
| More detail of all 3 literatures about GSTT1 | |
|
Pathways and Diseases |
|
Pathway | Drug metabolism - cytochrome P450;KEGG PATHWAY;hsa00982 |
Pathway | Metabolism of xenobiotics by cytochrome P450;KEGG PATHWAY;hsa00980 |
Pathway | Glutathione metabolism;KEGG PATHWAY;hsa00480 |
Pathway | glutathione-mediated detoxification;BioCyc;PWY-4061 |
Disease | cytogenetic studies;GAD |
Disease | leukemia, myeloid;GAD |
Disease | Premature birth;FunDO |
Disease | non-Hodgkin's lymphoma;GAD |
Disease | Hepatitis;FunDO |
Disease | cardiovascular;GAD |
Disease | colorectal cancer stomach cancer;GAD |
Disease | Periodontitis;FunDO |
Disease | Asthma;FunDO |
Disease | pneumonia;GAD |
Disease | Cancer;FunDO |
Disease | bronchitis;GAD |
Disease | Oral cancer;FunDO |
Disease | bladder cancer;GAD |
Disease | AGING;GAD |
Disease | Kuhnt-Junius degeneration;FunDO |
Disease | longevity;GAD |
Disease | nasopharyngeal cancer;GAD |
Disease | azoospermia oligospermia;GAD |
Disease | Chronic simple glaucoma;FunDO |
Disease | Amnionitis;FunDO |
Disease | arsenic toxicity;GAD |
Disease | lung cancer;GAD |
Disease | IMMUNE;GAD |
Disease | endometriosis;GAD |
Disease | coke-oven toxicity;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | leukemia, acute myeloid;GAD |
Disease | Vitiligo;FunDO |
Disease | Polycystic ovary syndrome;FunDO |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | pancreatitis;GAD |
Disease | 1-hydroxypyrene, urinary;GAD |
Disease | benzene toxicity;GAD |
Disease | leukemia;GAD |
Disease | colorectal cancer;GAD |
Disease | Autoimmune disease;FunDO |
Disease | METABOLIC;GAD |
Disease | Hepatitis, Autoimmune;FunDO |
Disease | esophageal cancer;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | REPRODUCTION;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | chemotherapy toxicity;GAD |
Disease | CANCER;GAD |
Disease | Cerebrovascular disorder;FunDO |
Disease | Fetal Growth Retardation;GAD |
Disease | Deafness;FunDO |
Disease | Kidney failure;FunDO |
Disease | Upper aerodigestive tract cancers;GAD |
Disease | prostate cancer;GAD |
Disease | Endometriosis;FunDO |
Disease | Birth Weight;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Hodgkin's disease;GAD |
Disease | Hypertension;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Dermatitis;FunDO |
Disease | Oligospermia;FunDO |
Disease | Pancreatitis;FunDO |
Disease | breast cancer;GAD |
Disease | Azoospermia;FunDO |
Disease | Barrett's esophagus;FunDO |
Disease | INFECTION;GAD |
Disease | Peptic esophagitis;FunDO |
Disease | stomach cancer;GAD |
Disease | arsenic metabolism;GAD |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 2952 |
Links to all GeneRIF Items | 2952 |
Links to iHOP | 2952 |
|
Sequence Information |
|
Nucleotide Sequence |
>2952 : length: 723 atgggcctggagctgtacctggacctgctgtcccagccctgccgcgctgtttacatcttt gccaagaagaacgacattcccttcgagctgcgcatcgtggatctgattaaaggtcagcac ttaagcgatgcctttgcccaggtgaaccccctcaagaaggtgccagccttgaaggacggg gacttcaccttgacggagagtgtggccatcctgctctacctgacgcgcaaatataaggtc cctgactactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca tggcagcacacgactctgcggagaagctgcctccgggccttgtggcataaggtgatgttc cctgttttcctgggtgagccagtatctccccagacactggcagccaccctggcagagttg gatgtgaccctgcagttgctcgaggacaagttcctccagaacaaggccttccttactggt cctcacatctccttagctgacctcgtagccatcacggagctgatgcatcccgtgggtgct ggctgccaagtcttcgaaggccgacccaagctggccacatggcggcagcgcgtggaggca gcagtgggggaggacctcttccaggaggcccatgaggtcattctgaaggccaaggacttc ccacctgcagaccccaccataaagcagaagctgatgccctgggtgctggccatgatccgg tga |
Protein Sequence |
>2952 : length: 240 MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR |