|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3094 |
Name | HINT1 |
Synonym | HINT|PKCI-1|PRKCNH1;histidine triad nucleotide binding protein 1;HINT1;histidine triad nucleotide binding protein 1 |
Definition | adenosine 5'-monophosphoramidase|histidine triad nucleotide-binding protein 1|protein kinase C inhibitor 1|protein kinase C-interacting protein 1 |
Position | 5q31.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 5 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Hint1 exerts its major cellular function as gene transcription regulator, and thus, this function provides its potential role as a tumor suppressor protein." |
reviewed | "Silencing of Hint1, a novel tumor suppressor gene, by promoter hypermethylation in hepatocellular carcinoma." |
reviewed | Ablation of the tumor suppressor histidine triad nucleotide binding protein 1 is protective against hepatic ischemia/reperfusion injury. |
reviewed | "The tumor suppressor function of HINT1 is caused by, at least in part, its normal role in enhancing cellular responses to DNA damage by regulating the functions of both gamma-H2AX and ATM." |
reviewed | Hint1 is a haplo-insufficient tumor suppressor in mice. |
| More detail of all 5 literatures about HINT1 | |
|
External Links |
|
Links to Entrez Gene | 3094 |
Links to all GeneRIF Items | 3094 |
Links to iHOP | 3094 |
|
Sequence Information |
|
Nucleotide Sequence |
>3094 : length: 381 atggcagatgagattgccaaggctcaggtcgctcggcctggtggcgacacgatctttggg aagatcatccgcaaggaaataccagccaaaatcatttttgaggatgaccggtgccttgct ttccatgacatttcccctcaagcaccaacacattttctggtgatacccaagaaacatata tcccagatttctgtggcagaagatgatgatgaaagtcttcttggacacttaatgattgtt ggcaagaaatgtgctgctgatctgggcctgaataagggttatcgaatggtggtgaatgaa ggttcagatggtggacagtctgtctatcacgttcatctccatgttcttggaggtcggcaa atgcattggcctcctggttaa |
Protein Sequence |
>3094 : length: 126 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHI SQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQ MHWPPG |