|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3400 |
Name | ID4 |
Synonym | IDB4|bHLHb27;inhibitor of DNA binding 4, dominant negative helix-loop-helix protein;ID4;inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
Definition | DNA-binding protein inhibitor ID-4|class B basic helix-loop-helix protein 27 |
Position | 6p22.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | Global assessment of promoter methylation in a mouse model of cancer identifies ID4 as a putative tumor-suppressor gene in human leukemia. |
potential | ID4 gene is a potential tumor suppressor gene for which methylation status may play an important role in the CRC progression. |
| More detail of all 2 literatures about ID4 | |
|
Pathways and Diseases |
|
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Disease | Rett syndrome;FunDO |
Disease | Cancer;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | alcohol dependence;GAD |
|
External Links |
|
Links to Entrez Gene | 3400 |
Links to all GeneRIF Items | 3400 |
Links to iHOP | 3400 |
|
Sequence Information |
|
Nucleotide Sequence |
>3400 : length: 486 atgaaggcggtgagcccggtgcgcccctcgggccgcaaggcgccgtcgggctgcggcggc ggggagctggcgctgcgctgcctggccgagcacggccacagcctgggtggctccgcagcc gcggcggcggcggcggcggcagcgcgctgtaaggcggccgaggcggcggccgacgagccg gcgctgtgcctgcagtgcgatatgaacgactgctatagccgcctgcggaggctggtgccc accatcccgcccaacaagaaagtcagcaaagtggagatcctgcagcacgttatcgactac atcctggacctgcagctggcgctggagacgcacccggccctgctgaggcagccaccaccg cccgcgccgccacaccacccggccgggacctgtccagccgcgccgccgcggaccccgctc actgcgctcaacaccgacccggccggcgcggtgaacaagcagggcgacagcattctgtgc cgctga |
Protein Sequence |
>3400 : length: 161 MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR |